KEGG   Myotis davidii: 102756757Help
Entry
102756757         CDS       T02992                                 

Gene name
CDC14A
Definition
(RefSeq) cell division cycle 14A
  KO
K06639  cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
myd  Myotis davidii
Pathway
myd04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:myd00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102756757 (CDC14A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:myd01009]
    102756757 (CDC14A)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102756757 (CDC14A)
    3.1.3.48  protein-tyrosine-phosphatase
     102756757 (CDC14A)
Protein phosphatases and associated proteins [BR:myd01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   CDC14
    102756757 (CDC14A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPn DSPc PTPlike_phytase Y_phosphatase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 102756757
NCBI-ProteinID: XP_015418998
LinkDB All DBs
Position
Un
AA seq 485 aa AA seqDB search
MVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRAL
LSGSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENG
DFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAIVRLNKKIYEAKRFT
DAGFEHYDLFFIDGSTPCDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYR
FTHAEVISWIRICRPGSIIGPQQHFLEEKQASLWVQGDLFRSKLKNRPSSEESINKILSN
LDDMSIGGNLSKIQNVERFGENNLEEDEDVEMKNSITQGDKLRALKSQRQPRSSPPYAFR
LDDMKGHPRAVVCQPFRLASSSQGSVSALKICKLASSPSATAKRITRGTLASGASGRSFS
VNSRLASSLGNLSAAAEDPDSRKTPACKGPPAAPSPRASVTGLSSSSARFLSRSIPSLQS
EYVHY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacagatactgctgtaagctgaacaagaaactgaaatcatacagtttatcaaga
aagaaaatagtgcattacacctgcttcgaccagcggaaaagagcaaacgcagcatttttg
ataggtgcttatgccgtcatctatttgaagaagactccggaagaggcctaccgagcgctc
ctgtccggctccaaccccccctaccttccgttcagggatgcttccttcggaaactgcacg
tacaacctcaccatcctcgactgtttgcagggcatcagaaagggattgcagcacggattt
ttcgactttgagactttcgacgtggatgagtacgaacactacgagcgagttgaaaatggt
gacttcaactggatcgttccggggaaattcttagcatttagtggaccgcatccaaaaagc
aaaattgaaaacggttaccccctccacgcccccgaggcctacttcccttacttcaaaaag
cacaacgtgacggccatcgtgaggctgaacaagaagatctacgaggccaagcgcttcacg
gacgcgggcttcgagcactacgacctcttcttcatcgacggcagcacgccctgcgacaac
atcgtgcgcaggttcctgaacatctgcgagaacacggagggggccatcgccgtccactgc
aaagccggcctgggcaggacggggacgctgatcgcctgctatgtcatgaagcactacagg
ttcacgcacgccgaggtcatctcctggatccggatatgccggcccggctccatcatcggg
ccccagcagcacttcctggaagaaaaacaagcatcgttatgggtccaaggagaccttttt
cgatccaaattgaaaaatagaccgtccagcgaagaaagtattaataaaattctttcgaac
ttggatgacatgtctataggtggaaacttatccaaaatacagaacgtggagcgatttgga
gagaacaacttagaagaggatgaggatgtggaaatgaagaacagcataacccagggagac
aaactccgtgccttaaagagccagcgccagccacgctcctcgccgccctacgccttcagg
ttggacgatatgaaagggcacccgagggcagtggtgtgccagcctttcagactggcttct
tcctcacaaggatctgtgtctgctctgaagatatgcaaactggcttcgtccccgtccgcc
acggccaagcggatcaccaggggcaccttggcctcgggcgccagtgggagaagcttctcc
gtgaactcgcggctggccagctccctggggaacctgagcgcggccgcggaggaccccgac
agcaggaagaccccggcctgcaaggggccccccgccgcccccagcccccgggcctccgtc
accggcctgtcctcctcctcggcccggttcctgagccggtccatcccctcccttcagtct
gagtatgttcattactaa

DBGET integrated database retrieval system