KEGG   Myotis davidii: 102756911
Entry
102756911         CDS       T02992                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
myd  Myotis davidii
Pathway
myd04010  MAPK signaling pathway
myd04014  Ras signaling pathway
myd04015  Rap1 signaling pathway
myd04072  Phospholipase D signaling pathway
myd04151  PI3K-Akt signaling pathway
myd04640  Hematopoietic cell lineage
myd04916  Melanogenesis
myd05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102756911 (KITLG)
   04014 Ras signaling pathway
    102756911 (KITLG)
   04015 Rap1 signaling pathway
    102756911 (KITLG)
   04072 Phospholipase D signaling pathway
    102756911 (KITLG)
   04151 PI3K-Akt signaling pathway
    102756911 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102756911 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    102756911 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102756911 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:myd04052]
    102756911 (KITLG)
Cytokines and growth factors [BR:myd04052]
 Growth factors
  Growth factors (RTK binding)
   102756911 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102756911
NCBI-ProteinID: XP_015426630
LinkDB
Position
Un
AA seq 279 aa
MLFIMYAVFKTWIITCIYLQLLLFNPLVRTTGICTNRVTDDVKDVTKLVTNNPKSFYLCF
IFLPFNFLQPSHCWISKMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECM
EEHPLENVKKSSNSLELKMFTPEEFFRIFNRSINAFKDLEIVSSKTSECVFSSTLSPDND
SRVSVTKPFMLPPVAANSLRNDSSSSNRKALNSIGDSKLQWAAMTLPAFFSLLVGFGFGA
LYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 840 nt   +upstreamnt  +downstreamnt
atgctttttataatgtatgctgttttcaagacttggattatcacttgcatttatcttcaa
ctgctcctctttaatcctctcgtcagaactacagggatctgcacgaaccgtgtcactgat
gatgtgaaagacgttacaaaattggtgaccaacaatcctaaaagtttttatttatgcttt
atctttctccctttcaatttcttgcagcctagtcattgttggataagcaaaatggtggag
caattgtcagtcagcttgactgatcttctggacaagttttcaaatatttctgaaggcttg
agtaactattctatcatagacaaacttgtgaaaatagtagatgaccttgtggagtgcatg
gaagaacacccattggagaatgtaaaaaagtcatctaacagcctagaactcaagatgttt
actcctgaagaattctttagaatttttaatagatccatcaatgccttcaaggacttggag
atagtgtcatctaaaactagcgaatgtgtgttttcttcaacattaagtccggacaatgat
tccagagtcagtgtcacaaaaccatttatgttaccccctgttgcagccaactcccttagg
aatgacagcagtagcagtaataggaaggccttgaattccattggagactccaagctgcaa
tgggcagccatgacgttgccagcattcttctctcttttagttggctttggttttggagcc
ttatactggaagaagaaacaaccaaatcttacaaggacagttgaaaatatacagattaat
gaagaggataatgagataagtatgttgcaagaaaaagaaagagagtttcaagaagtctaa

DBGET integrated database retrieval system