KEGG   Myotis davidii: 102757613Help
Entry
102757613         CDS       T02992                                 

Gene name
AMY2A
Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
myd  Myotis davidii
Pathway
myd00500  Starch and sucrose metabolism
myd01100  Metabolic pathways
myd04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102757613 (AMY2A)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102757613 (AMY2A)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102757613 (AMY2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase LSR
Motif
Other DBs
NCBI-GeneID: 102757613
NCBI-ProteinID: XP_006763007
LinkDB All DBs
Position
Un
AA seq 528 aa AA seqDB search
MWNINSGWKEPGQLQSKMKFLLLLSALGFCWAQYAPHTKPGRTSIVHLFEWRWADIALEC
ERYLGPKGFGGVQISPPNENVIINNPSRPWWERYQPISYKLCTRSGNEDEFRDMVTRCNN
VGVHIYVDAVINHMCGNGVSPGTSSTCGSFFNPGSRDFPSVPFSAWDFNDGKCRTASGDI
ENYNDAYQVRDCRLVGLLDLALEKDYVRSKVAEYMNHLIDIGVAGFRIDASKHMWPGDMK
AVLDKLQPLNTTWFPEGSKPFIYQEVIDLGGEPIKSSDYFDNGRVTEFKYGAKLGTVLRK
WHGEKMAYLRNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMGVAFM
LAHPYGFTRIMSSFRWPRYFVNGKDINDWVGPPNTNGVIKEVTINPDTTCGNDWVCEHRW
RQIRNMVMFRNVVDGELFTNWWDNGSNQVAFGRGNKGFIIFNNDDWPLSSYLQTGLPAGT
YCDVISGDKIGDKCTGIKIYVSADGKAQFSISNTAEDPFIAIHVESKL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatataaatagtggctggaaagaacccggacaacttcagagcaaaatgaagttc
ctgctgttgctctcggccctcgggttctgctgggctcagtacgccccccacaccaagcct
gggcgcacctccatcgtccacctgtttgagtggcgctgggctgacattgccctggaatgt
gagcggtacttgggtcccaaaggattcggaggggtgcagatctctccacccaatgaaaat
gttatcattaataacccttcaagaccttggtgggaaagataccaaccgattagctacaag
ttatgtacaagatcaggaaacgaagatgaattcagagacatggtgaccagatgtaacaac
gttggcgtccacatttacgtggatgcggtgatcaaccacatgtgcggcaatggcgtgagc
ccggggaccagcagcacctgcgggagtttcttcaaccctggaagccgggacttcccctcg
gtcccgttctcggcctgggatttcaatgatggtaaatgcagaaccgcaagtggggacatc
gagaactacaatgacgcttaccaggtcagagactgtcgcctggtcggccttcttgacctc
gccctggagaaagactacgtgcgctccaaggtggccgagtacatgaaccacctcattgac
atcggcgtggctggcttcagaatcgacgcctccaagcacatgtggcccggagacatgaag
gcggttctggataaactgcagcctctgaacacaacctggttccctgaaggaagtaaacct
ttcatttaccaggaggtaatcgacctgggtggtgagcccattaagagcagtgattacttc
gacaacggccgcgtgacagagttcaaatatggtgccaaactgggcacagtgctgcgcaag
tggcatggggagaagatggcctatctgaggaactggggagaaggctggggcttcatgcct
tccgacagagccctcgtctttgtggacaaccacgacaaccagcggggacacggcgctgga
ggctcatccatccttaccttctgggacgccagactctacaaaatgggagtggcatttatg
ctcgcccatccatatgggttcacacgcatcatgtcaagcttccgttggccacggtacttt
gtgaatggaaaagatattaatgattgggttgggccaccaaatactaatggagtaattaaa
gaagtcactattaacccagacaccacctgcggcaacgactgggtctgtgagcatcgctgg
cgtcaaatcaggaacatggtcatgttccgtaatgtggttgacggtgaactttttaccaac
tggtgggataatggtagcaaccaagtagcttttggaagaggaaacaaaggattcattatc
tttaacaatgatgactggccattgtcttcctatttgcaaacgggtcttcctgctggcacc
tactgcgatgtcatttctggagataaaattggtgacaagtgtacaggaatcaaaatctac
gtctccgctgacggcaaagctcaattctctatcagtaacactgccgaagatccatttatt
gcaatccatgtggaatctaaattataa

DBGET integrated database retrieval system