KEGG   Myotis davidii: 102758217
Entry
102758217         CDS       T02992                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
myd  Myotis davidii
Pathway
myd04060  Cytokine-cytokine receptor interaction
myd04151  PI3K-Akt signaling pathway
myd04210  Apoptosis
myd04630  JAK-STAT signaling pathway
myd04640  Hematopoietic cell lineage
myd05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102758217
   04151 PI3K-Akt signaling pathway
    102758217
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102758217
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102758217
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102758217
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102758217
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:myd04050]
    102758217
   04090 CD molecules [BR:myd04090]
    102758217
Cytokine receptors [BR:myd04050]
 Interleukin receptor families
  IL3 receptor family
   102758217
CD molecules [BR:myd04090]
 Proteins
  102758217
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 102758217
NCBI-ProteinID: XP_015425955
LinkDB
Position
Un
AA seq 222 aa
MEPGTKRLTWDLHGNVSGIKCTEGPSSDLKAKHNLFCQFYVLPKCTRTNYTIKVAVVDGE
PYSTWIEYPKQEGNPGAAAEGLACEVHDKDALTCRWAVGRAAPSDVQYYFYLEDTSSDQM
WACPRYTMKEGKHIECRFDVSAFYNRRQDPFYRFWVTGTSHREAIPCSELFSNLRKIEKL
IAPNISATCNTSLALLQWDMSSHLHRLFDYDLEIQQVNPSVL
NT seq 669 nt   +upstreamnt  +downstreamnt
atggagcccgggaccaagaggctgacctgggatctccacggcaacgtctccggcatcaaa
tgcaccgaaggtcccagttccgacctaaaggccaaacacaaccttttctgccagttctat
gtgctccccaaatgcacgcggacgaactacacgatcaaagtcgccgtggtcgacggtgag
ccatactccacgtggattgagtatcccaagcaagaagggaacccgggggcagctgctgag
ggcctggcctgcgaggttcatgacaaggacgccctgacctgcaggtgggcggtgggccgg
gcggcccccagcgatgtccagtattatttctacttggaggacaccagctccgatcagatg
tgggcgtgtcccaggtacacgatgaaggagggcaaacacatcgagtgtcggtttgacgtc
tctgccttttacaaccggagacaagacccgttctaccggttctgggtgacgggcaccagc
caccgggaggccattccctgctctgaattattctccaatttgcgcaagatcgagaagttg
atcgcacccaacatcagtgccacgtgcaatacgtctctcgcgctcctgcagtgggacatg
tccagccacctccaccgtctgtttgactacgacctcgaaatacaacaggtcaacccttcc
gtcctttga

DBGET integrated database retrieval system