KEGG   Myotis davidii: 102758485Help
Entry
102758485         CDS       T02992                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
myd  Myotis davidii
Pathway
myd00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102758485 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myd03036]
    102758485 (SETD2)
Enzymes [BR:myd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102758485 (SETD2)
Chromosome and associated proteins [BR:myd03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102758485 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 102758485
NCBI-ProteinID: XP_006770628
LinkDB All DBs
Position
Un
AA seq 2542 aa AA seqDB search
MLSSLKGPYDMLCYVEGVSFQICFPLGEEENEAKIENVQKTGFIKGPVFKGVASSRFLPK
GTKTKVNLEEQGRQKVSFSFSLTKKTLPNRFLTALGSDKQSDAPASPAVPLQVDLTPKTK
VDVGETLSTAEDSSPPKSRVELGKIHFKKHLLHVTSRPLLATTTPVTSPPPTEPLPAVIA
ESTTVDSPPSSPPPPPPPPPQATIPSPLAPVTEPVALPHAPIMVLMTAPADTAVRALKEP
PVTIEPESSEADTKQDTVSNSSEEHMAPTLSEQAHLPSQKEDSHIGKGEESPDSSKRSLS
LRKTGSKKKPSQSEGTFLGSESDEDSVRTSSSQRSHDLKFPASIEKERDSKKSLAPLKSE
DLGKSSRSKTERDDKYFSYSKLERDTRYMSSRCRSERERRRSRSRSRSDRGSRTSLSYSR
SERSHYYDSDRRYRSPYRERARYSRPHTDNRARESSDSEDEHKKTYSRRTSSHSSYRDLR
TSSSYSKSDRDCKTESHSEMEKRGKYSSKPERESRRTSENEAMKRCCSPLNELGFRRGSS
YSKHENSASRYKSAPSKSISKSDKSKNSFCCAELTEEIKHTHSFSLQTHCSKGSEVRVIS
KLPEREKTGSPLSNRLNDSPAFKKLEEPPIFKSEFIGHDSHDSIKELDSLSKMKNDQLRS
YCPMELNINGSPDAESDLVTFCTSKTDTVLMSSDDSVTGSEASSLVKACVLSSNGFQNID
SCKEKDLDDTCMQCSKAESPFRETEPPVSPHQDKLMSLPVMTVDYCKTIGEEPVDMRVSS
CKAKDSDVYCASNDNNPSLCHSAAEDTEPPVRKISSNSFMNVHLKSKTVICDHRSLTDQH
SKFACKEYKSVGSTSSASVNHFDGLYQPIESSGIASSLQSLPPGITVDSLALLQCGENTS
PVLGAVLKSKSTEFAKHGEKEMLEVGSGLPALGRGVASWENRHNNGLSGKCLHEAQEEGD
SMLPDKRGRPEISLEEEGGRGHEHTSDDSEVVFSSCELNLTTEDSEYMTYTLKCDSSGHA
SEIVSTVHEEYSGSSESSSDESDSEETDSDDSSIPRNRLQSVVVVPKNSTLPMEETSPCS
SRSSHSYRHSSDHWEDERLEPRRHSYEEKFESIASKACPQTEKFFLHKGTEKSPEMCFTQ
MSRKQIDNHLTEVAHPQSDGVDSTSHSDVKSDPGGHPGFEETLRAKIASRQEELPLYSSD
GFEDVQNKCWQQTPFPDRPDSRLGRTELNFSSSYEISRVDGFHSSGLYKVLELRNMGWDF
SPQEKPTTTYQQPDSSYGGRAGHKYQQGTEPYAGTRSSWQGNGYWDPRSAGRPPGTGVVY
DRVQGQVPDSLTDDREEEENWVDKGSVQAPEISSNSIKDLLVINDKKALSKNLEKNDMKD
RGPPKKRRQELESDSESEGELQDRKKVRVEAQPCEMAAPPGSALAGPSCVMEDFRDPQRW
KECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECAPLSKEERAQGEIACGEDC
LNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYC
GEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKW
TVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAA
GGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQN
THSQSRLKSFLERHGLSLLWIWMAELGDGRESNRKLQEEIIKTLEHLPIPTKNMLEESKV
LPIIQRWSQTKTAVPQLSEGDGYSSENTSRAHTPLNTPDPATKLSTEADTDTPKKLMFRR
LKIISENSMDSAISDATSELEGKDGKEDLDQLETIPVEEEDELQSQQLLTQQLPESKVDS
EIAGEASKLPTPEPEADVEVEPKESHSAKLEEHVAGETPSQDEEEGVSDVESERSQEPPD
KTVDISELATKLLDSWKDLKEVYRIPKKSQTEKESTVTERGRDAAVFRDQTTAPKTPNRS
RERDTDKQTQSKEKRKRRGSLSPPSSAYERGTKRPDDRYDTPTSKKKVRKDRNKLSTEER
RKLFEQEVAQREAQKQQQQMQNLGIASPLPYDSLGYSAPHHPFAGYPPGYPMQAYVDPSN
PNAGKVLLPTPSLDPVCSPAPYDHSQPLVGHSTEPLAAPPPVPVVPHVTAPVEVSSSQYV
AQSEGVVHQDSSVTVLPVPAAGPVQGQNYGVWDSNQQPVSVQQPYSTPTQSQPSIYYQGQ
TCPTVYGVTSPYSQTTPPIVQSYAQPSLQYLQGQQLFSAPGVVVQPAAAVTTVVAPGQPP
PLQPPEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTW
ESPGDEASLEHEAEMDLGTPTYDENPMKASKKPKTAEADTSSELAKKSKEVFRKEMSQFI
VQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKE
YIKKYMQKFGAVYKPKEDTELE
NT seq 7629 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcagtttaaaagggccttatgacatgttgtgctatgtggaaggtgtctccttt
caaatctgtttccccctgggggaagaagaaaatgaggcgaagattgaaaatgtgcagaaa
acaggtttcatcaaaggaccggtgttcaaaggtgttgcttccagtcggtttttgcccaaa
ggcaccaagacgaaagtcaatttggaggaacaggggcgacagaaggtgtcattcagcttc
agcctcacaaagaaaactttgccgaacaggtttctgactgcacttggcagtgacaagcaa
agtgatgctccagcctccccagctgtacctcttcaagtagacttgacccctaaaactaaa
gtggacgttggcgagaccttatctactgcagaagactcttccccaccaaaatcaagggta
gaattgggaaaaattcattttaagaaacatctgcttcatgtaacatccaggccactgcta
gctacgaccacaccagtgacatcacctccgcccacagaaccgttaccagcagtcatagca
gaatcaacaactgtagactcaccaccttcatctccacctcctccacctcctccacccccc
caagccacaataccctcaccactagcaccagtaacagagccggtggccttgccacatgca
ccaataatggttctgatgacagcaccggcagatacagcagttagagccttgaaggaacca
ccggttacaattgaaccggaatcctcggaagcggacactaagcaggacactgtatctaac
agttcagaagaacacatggctccgactttgagtgagcaagcacatcttccctcacagaaa
gaagactcccatattgggaagggggaggagagtccagatagttctaagaggagtctgagc
ttgagaaagacaggttctaagaagaaaccctcacaatctgaaggcacctttcttggttca
gaatctgatgaagattctgttcggacttcctcaagtcagagatcacatgatttaaaattt
ccagcaagcattgaaaaggaaagagattcaaaaaagagcttagcacctttaaaaagtgaa
gatttagggaaatcttcccgatctaaaacagaaagagatgacaaatattttagttactca
aaacttgaaagagatactcggtatatgtcctctcgatgtagatcagagagagagcgaagg
cgaagcagatctcgttctagatctgacagaggctctagaactagcttatcttattcccgg
tcggaacgatcccattattatgactctgatcgtcgctaccgttccccttatcgagagagg
gcacgttattctcggccgcatacagataacagggcacgagagagttctgattccgaagat
gagcataaaaagacatactcaaggcgcacctcatctcattcctcttacagagacctaagg
acatcatcatcctattctaaatccgatcgggactgcaaaactgaatctcactcagagatg
gagaaaagagggaagtattcttcaaaaccagaaagagaatccagaaggacttcagaaaat
gaagcaatgaaaaggtgttgttctccccttaatgaactgggattccgacgggggtcatca
tattccaagcacgaaaacagtgcttcccgttataaatctgctccttcaaaatctatatcc
aaatctgataaatcaaaaaattctttctgttgtgcagaattaactgaggaaatcaaacac
actcattcttttagtttacagactcattgttcaaagggtagtgaagtcagggtgattagt
aaacttcctgaaagagaaaagacgggatctcctctatcaaatcgattaaatgattcacca
gcttttaaaaagctggaagaaccgcctatttttaaatctgaatttataggacatgatagc
catgatagtattaaggaattagattctttatctaaaatgaagaatgatcagttaagaagt
tactgtcccatggaattaaatataaatggatctcctgatgcagaatctgatttggtaaca
ttttgcacttctaaaactgacactgtcttgatgtcttctgatgacagtgtgactggatcg
gaggcatcctctttggtcaaagcatgtgtgctttcatcaaatggatttcagaacattgac
agttgtaaagaaaaagacttggacgatacttgcatgcagtgtagtaaggcagaaagcccg
tttagagaaacagagcctccggtgtcaccacaccaagataaactcatgtctttacctgtt
atgactgtagattactgcaaaactataggtgaagaaccagttgatatgagagtttctagc
tgtaaagccaaagattcagacgtgtattgtgcttcaaatgacaacaacccttctttgtgt
cattctgcagctgaagatactgagcctccagttaggaagatttcttcaaatagctttatg
aatgtgcatttgaaatcaaaaacagttatatgtgatcatcgaagtctgacagatcagcac
tcaaaatttgcatgtaaggaatataagagtgttggtagcactagttcggcttctgttaat
cattttgatggtttatatcaacctatagagagttcaggcattgcttcatctcttcagagt
cttccaccaggaataacagtggacagtttagctctcttgcaatgtggagagaacacatct
ccagttttgggtgctgttctgaagagtaaaagcacagagtttgcaaagcatggagaaaaa
gaaatgctagaagtaggcagtggccttcctgctttaggtaggggggttgcttcctgggaa
aacaggcataataatgggctctctgggaaatgtctgcatgaggctcaagaagaaggggat
agcatgttgcctgataaaagaggaagaccagaaatctctctagaagaagagggaggtaga
ggacatgaacacacttctgatgattcagaagttgtattttcttcttgtgagttgaattta
accacggaagacagcgagtatatgacatacaccttaaagtgtgacagtagtggtcatgcc
tcagagatcgtgtctactgttcacgaagagtattctggttcctctgaaagttcaagtgat
gaaagcgattcggaagagacagattctgacgacagcagtattcccaggaaccgtcttcag
tcggtggtggttgtgccaaagaattcgactttgcccatggaagaaacaagtccgtgttct
tctcggagcagtcacagttacagacactcttctgaccactgggaagatgagagattggag
cccaggaggcattcatatgaggaaaagtttgagagcatagcaagtaaagcctgtcctcag
acggagaagttcttccttcataaaggaacagagaagagtccagaaatgtgtttcacacag
atgagcagaaagcagatagacaaccacctgactgaagttgctcaccctcagagtgacgga
gtcgatagtacaagtcattctgatgtaaagtcggaccctggaggtcatccaggttttgaa
gaaacactgagagccaaaatagcttccaggcaagaggagttgccactttattcttctgat
ggttttgaagatgttcaaaataagtgttggcaacagacccctttccctgataggccagat
agtagactgggaagaacagaattgaatttctcttcctcttacgagatctcccgagtggat
ggcttccattcatcgggtctttacaaagtgctagagctcagaaacatgggctgggacttc
tctccacaagaaaagccaacgaccacgtaccagcagcctgacagcagctatggaggccgt
gctgggcacaagtatcagcagggcacagagccgtacgctgggacacggagttcctggcaa
ggcaatggctactgggatcccaggtcagcaggtagacctcctggaactggggttgtgtat
gatcgagttcaaggtcaggtaccagactccttaacagatgatcgtgaagaggaagagaat
tgggtcgacaaggggtcagtgcaagcacctgaaataagcagcaattccattaaggactta
ttagtcataaatgacaagaaagctctttcaaaaaacttagaaaaaaatgatatgaaagat
agagggcctcctaaaaaaaggaggcaggaattggagagtgattctgaaagtgagggtgag
cttcaggacagaaagaaggtgcgagtggaggcacagccgtgcgagatggcagcgccccca
ggctcggcgctggccgggccttcctgtgtcatggaggacttcagagacccccagcgatgg
aaggaatgcgccaagcaggggaagatgccttgttactttgatctgattgaagaaaatgtt
tatttaacagaaagaaagaagaataagtcccatcgggacattaagcggatgcagtgcgag
tgcgcgcctctttctaaagaggagagagctcagggtgaaatagcctgtggggaagactgc
ctcaaccgcctcctcatgatcgaatgttcttctcggtgtccaaacggggattactgttcc
aatagacgattccagaggaaacagcatgcggatgtggaagtcatactcacagagaagaaa
ggctggggcttgagagctgccaaagaccttccttcgaacacctttgtcctggagtactgt
ggagaggtccttgatcataaagagtttaaagcccgggtgaaggagtacgcgcggaacaag
aacatccactactacttcatggccctgaagaacgatgagataatagatgccactcagaaa
ggaaattgctctcgttttatgaatcatagctgtgagccaaactgtgagactcaaaaatgg
actgtgaacggacagctgagggttgggttttttaccaccaaactggttccttcaggctcc
gagttgacatttgactaccagttccagagatacggaaaagaagcgcagaaatgtttctgt
gggtcagctaattgccggggttacctgggaggagagaacagagtcagcattcgagcagca
ggagggaaaatgaagaaggaacgatcccgtaagaaagattcagtggatggagagctagaa
gcgctgatggagaacggggagggtctctctgataaaaaccaggtgctcagcttatcccgg
ctaatggttagaattgaaactttggaacagaaacttacctgtctcaagctcatccagaac
actcactcccagtctcgcctgaagtcctttctggagcgccacgggctgtctttgctgtgg
atctggatggcggagctgggggacggccgggaaagcaaccggaagcttcaggaggagatt
ataaagactttggaacacttacctattcctactaaaaatatgttggaagaaagcaaagta
cttccaattattcagcgttggtctcagaccaagactgctgttcctcagttgagtgaagga
gatgggtattctagtgagaacacgtcacgggctcacacgccgctcaacacacctgatccc
gccaccaagctgagcactgaagctgacacagacacccccaagaagctcatgtttcgcaga
cttaaaattataagcgagaacagcatggacagtgccatctctgatgccactagcgagcta
gaaggcaaagatggcaaagaggaccttgaccagttagaaaccatccctgtagaagaagag
gatgagttacagtcacagcagctgctcacacagcagttgccagagtctaaagttgatagt
gaaattgctggggaggccagtaagctgcccacccctgaaccggaggctgacgtcgaagta
gagccgaaagagagccacagcgcgaagctagaagagcatgttgctggggaaacgccgtcc
caggacgaagaggagggcgtgtctgacgtggagagtgagaggagccaggagccgccagac
aaaaccgtggacatcagcgagttggccaccaagctcctggatagttggaaagacctgaag
gaggtctatcgaattccaaagaaaagtcagacggagaaggagagcacagtaactgagcga
ggaagggatgctgctgtcttcagagatcaaaccactgccccaaagactcctaaccggtca
agagagagagacacagacaagcaaactcaaagtaaagagaaaaggaaacgaaggggctct
ctctcaccgccctcctctgcctatgagcgagggacaaaaaggccagatgacagatatgat
acaccaacttctaaaaagaaagtacgaaaagaccgcaataaactttctacggaggagcgt
cggaagttgtttgagcaagaggtggctcagcgggaggctcagaaacagcagcagcagatg
cagaacctgggaatagcatctccactgccctacgactctcttggctacagtgcccctcat
cacccctttgccggctacccaccagggtaccccatgcaggcctatgtggaccccagcaac
cccaatgctgggaaggtgctcctccccacccccagcctggaccctgtgtgctctcctgct
ccttacgaccattctcagcccttggtgggacattctacagagcccctggctgcccctcca
cctgtgccagtggtgccacatgtgacagcccctgtggaagtttccagttcacagtatgtg
gcccaaagtgaaggtgtggtacaccaagactccagcgtcaccgtcttgcctgtgccggcc
gcgggcccagtccagggacagaactacggtgtttgggattccaaccaacagcctgtcagc
gtgcagcagccgtactcgacgcccacacagtcgcagccaagcatctattaccaaggacag
acgtgtccaaccgtctatggtgtgacatcaccctattcacagacaacgccaccgattgta
cagagttatgcccagccgagtctgcagtacctccaggggcagcagctcttctcagctcca
ggagtggtggtccagccagccgccgccgtgacgacggtcgtggcgccagggcagcctccg
cccttacagccacctgaaatggttgtgacaaataatctcctggacctgccgcctccctct
cctccaaaaccaaaaaccatcgtcttgcctcccaactggaagacggcccgcgaccctgag
gggaagatttattactaccacgtcatcaccaggcagactcagtgggaccctcccacgtgg
gagagcccaggcgacgaggccagccttgagcatgaagctgagatggacctgggaaccccg
acatacgatgaaaaccccatgaaggcctcaaaaaagcccaagactgcggaggcagacacc
tccagcgagctggccaagaaaagcaaggaagtgttcagaaaagagatgtcccagttcatc
gtccagtgcctgaacccttaccggaaaccagactgcaaagtggggagaatcaccaccacc
gaagacttcaagcacctcgcccggaagctgactcacggcgtcatgaacaaggagctgaag
tactgcaagaacccggaggacctggagtgcaacgagaacgtgaagcacaagaccaaggag
tacatcaagaagtacatgcagaagttcggggctgtttacaaacccaaagaggacacggaa
ctggagtga

DBGET integrated database retrieval system