KEGG   Myotis davidii: 102758728Help
Entry
102758728         CDS       T02992                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
myd  Myotis davidii
Pathway
myd00052  Galactose metabolism
myd00500  Starch and sucrose metabolism
myd01100  Metabolic pathways
myd04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102758728 (MGAM2)
   00500 Starch and sucrose metabolism
    102758728 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102758728 (MGAM2)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102758728 (MGAM2)
    3.2.1.20  alpha-glucosidase
     102758728 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102758728
NCBI-ProteinID: XP_015428145
LinkDB All DBs
Position
Un
AA seq 2156 aa AA seqDB search
MARKLGVFEIFLFICFLIVLAADIFLLFLVLDNTPDPPFSPQCTEIPESHRIDCAPGEMV
SKETCRDRYKCCWKPVSDTNVPRCFFPRNWGYEVNGSLKHEHTGLTAGLKKLSNPPRFGN
DVPNANFTAEYQTPRRLRFKITETNNTRYEVSHEHVKLFNMTAGSTNRSYHVEVIEKPFG
IKIMRKSNKKVLLDTSIGPLLFANQYLQLSFLLPSANVYGLGEHVHQQYRHDMSWKTWPI
FTRDATPTKGMINLYGAHTFFLCLEDTSGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
FDFYVFLGDTPEQVVQEYLELVGRPFLPSYWNLGFQLSRRNYNNIEGLKEVVERTRKARI
PYDVQYSDIDYMDGKKDFTIDEKAFPGLSDFAKNLHEHGQKYVIIMNPGILHDSEYQPYK
NGRKKRVWVLGNKGFVTGQGYPGKIVFPAYDNPFCTQWWTEELQEFHKTLEFDGVWLEME
EVSVLQGSDHGCEDNNWNYPPFTPRVLDRSLFAGTLCMDAEVYQELHYNVHSLYGYSMAR
ATDSALNTVFPKKRNFILSRSTFAGSGKFAAHWLGDNAAAWDDLRWSIPSILEFNLFGIP
MVGANICGYKNNTTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFGEDSQLLSSSRHY
LNIRYTLLPYLYTLFYRAHTRGETVARPLVHEFYQDNATWDVHEQFLWGPGLLITPVLYE
GVDRVKAYIPDAIWYDYETGTAIQWRKQLVEMQLPPDRIGLHLRGGYIFPIQQPNTTTEA
SRKNSLGLIIALDYKREAKGELYWDDGISADAVTEKNYTLYEFSVTSNHLQAKITNNYMD
SDNLTFTDITILGMDKEPTNFVLNDIDILNVSYNASTKVVKITDLEGLVLGQEFSMRWTL
LVSNQEKFNCYPEEPTPSEEKCKQRGCLWENTDVPGVPTCFYDTIPKYAPSNIQYSPTGI
TTDLTHLTAPESARAAAPSLRSTRRTPAAAATTSHPLSAEISSLRISVIYHTESMLQFKI
YDPTNKRYEVPVPLNIPSSPVGSPENRLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFT
FNDMFLSISTRLPSENIYGFGETEHTTFRRNISWNTWGIFSRDEPPGYKKNSYGVHPYYM
GLEEDGNAHGVLLLNSNAMDVTLQPTPALTYRTTGGILDFYVVLGPTPELVTQQYTELIG
RPAMVSYWALGFQLSRYGYQNDTEISNLYDEMVEANIPYDVQHVDIDYMDRKLDFTLSTS
FQNLSLLMERMKKNGTRFVLVLNPGISRNETNYLPFTTGQENNVFIKWPNSSDIVWGEVR
WEEMPLYKVHIAYPDFLRNSTAAWWKEEIKKLYTSPKSLKFDGLWIDKNEPSNFVDGSVS
GCRDEILNKPPYMPYLESRDRGLSSKTLCMESEQILPDGSRVRHYDVHSLYGWSQTRPTY
EAVQEVTDQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLRKSIIGMMEFSLFGIPYTGA
NICGFLGNAEYEMCLRWMQLGAFYPFSRNHNTIGTRRQDPVAWNSTFQMYSKKVLQTRYT
LLPYLYTLMHKAHVEGSTVVRPLLHEFREDRTTWDIDRQFMLGPAVLISPVLTSNTFEVH
AYFPRARWYDYSMESGNTSTGEWRILEAPLDHINLHIRGGYILPWQEVAMNTHSSRQLFM
GLIVALDDNGKAEGQMFWDDGQSIVSYFKLLYLVARYSVIENILQIQTMHNKYLNDSNQL
KVGYIKIWGIHSTDVTQVNVTYNNKQFTTMNFTSDPYNQTLTIQLINKIFRLEKLTEVTW
SHNVPNVTSTPMTSTFSSTSPDPTSTIIATISESIVTSSASNSTASPIITTSFPTNSNAT
STNNTLPITMIPSLTNTETDTTSMDSVTTNVLNTTTARNTKTTTAITTLTLITNATSEQP
TTVIMSTLPPTGTLGITTTDNVLTRISTTTYPPDTPTHALSTTSRSTQSTTNTNITNMTT
GVTDIINTSTATSSHMNITDIKSTTKVAGNAVTAYTTTITTSVFSTKTINSNTTSDTIFT
NTYIPSTTAIPTTNTSKITEHSENIADADNSRRVFIPNTIVASDSLTPFLDTATHHHVTT
NSTTSFLPLIVTNATTAITNVTIYASNTIIPDRTPMDASTTALTYIANTKNTTVVP
NT seq 6471 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcggtgtgtttgaaatctttctgttcatctgcttcctaattgtattg
gccgcagatatcttcttgctgtttctggtgcttgataatactccagatcctccatttagt
ccacagtgcactgagatccctgaatcacataggatagactgtgcgcctggcgagatggtg
tcaaaggaaacctgccgggatagatacaagtgctgctggaagcctgtgtcagacaccaat
gtccccaggtgcttcttccccaggaactggggctatgaagtcaatggaagccttaaacat
gaacacacagggttaactgctggcttgaaaaagttgtcaaacccacctcggtttggaaat
gatgtccctaatgccaacttcacagctgagtatcagacacccaggcgtcttcgttttaag
atcactgaaaccaataacacacgctatgaagtctcccatgagcatgttaagctgtttaat
atgactgctggttccaccaaccggagctatcacgtcgaggtcatagagaaaccctttggc
atcaaaataatgaggaagagcaacaaaaaagtcttgttggacacgagcattgggcccctc
ctgttcgccaatcagtacctgcagctgtccttcctgctgcccagcgccaacgtgtatggg
ctgggagaacacgtgcaccagcagtaccgccacgacatgagctggaagacctggcccatc
ttcacccgggatgccacccccaccaagggcatgattaacttgtatggagcccacacattc
ttcttgtgccttgaagataccagtggctcctcttttggggtctttctgatgaacagtaat
gctatggaggtcacccttcagccagctcctgcaatcacttaccgcaccatcgggggcatt
tttgacttttatgtgttcctgggagacactccagaacaagtggttcaggaatacctggag
ctcgttggacggccattcctgccttcctactggaatcttggtttccagcttagtcgcagg
aattataataacatcgagggattgaaagaggttgtagagcgaactcgtaaagctaggatc
ccatatgatgttcagtactcggacatagactacatggatggaaagaaggacttcactatt
gatgaaaaggctttccctggtctctcagattttgccaagaacttacacgaacatggacag
aaatatgtaattattatgaatcctggcatcttacatgattctgaataccagccctataag
aatggaagaaaaaagagagtatgggtcttggggaataaaggctttgtcactggacaggga
taccctgggaagatagtctttcctgcttatgataatccattttgtactcaatggtggaca
gaagagcttcaagaatttcataaaactttggagtttgatggagtgtggcttgaaatggag
gaagtatctgttctccaaggttctgatcatgggtgtgaagataacaactggaactaccct
cctttcactccccgagttctggaccgctcgctttttgcaggaactctctgcatggacgcc
gaagtttaccaggagcttcactataatgtccacagcctgtatggctactccatggcaaga
gccacagactcggccttgaatactgtcttccccaaaaagaggaacttcatcttgtcccgt
tctacttttgctgggtctggcaagtttgcagctcattggttaggggacaatgcagctgca
tgggatgatcttcgatggtccatacctagtatccttgagttcaacctatttggcatcccc
atggtcggtgccaatatctgtggttataaaaataataccacagaggagctctgcagaaga
tggatgcagcttggagcattttatccactatccaggaatcacaatgggcctgggttcagg
gaccaggaccctgctgcctttggtgaagactctcagctattgagttcctccaggcattat
ctgaacatccgctacaccctgctgccttatctctacactctcttctaccgagctcatacc
cggggggaaactgtagcgaggcccctggtccacgagttctaccaggacaatgctacatgg
gatgtgcatgagcagttcttatggggacctggactcctcatcacgcctgtgttatatgaa
ggtgtggaccgggtgaaagcatacataccagatgccatctggtacgactatgagacagga
acagccatccaatggaggaaacaattggtggagatgcaactgccccctgataggatagga
cttcaccttcgagggggctacatatttcccatccagcagccaaacacaaccacagaggcc
agtcggaagaactccctgggactcattattgccttggactacaagagagaagcaaaggga
gagctgtactgggatgatggtatatctgcagatgctgtaacggaaaagaattatactctg
tatgagttttctgtcacctcaaaccatctacaagcaaagattacaaataattatatggat
tccgacaacctcacatttacagatatcacaatcttgggaatggacaaagaacctactaat
tttgtccttaatgatattgacattttaaacgttagctacaatgcatcaacgaaggtggtg
aaaatcactgatctcgagggactggtactgggacaagaattctccatgaggtggactctt
ttggtcagtaaccaagagaagttcaactgctaccctgaggagcccactccctctgaggag
aagtgcaagcagcgggggtgcctttgggagaacacagatgttcctggtgtgcccacctgt
ttctatgacaccatccctaagtatgctcccagtaatattcagtactcgcccactggcatc
accacagaccttacccacctgacagcccctgagtcagctcgagcagcagcaccatcacta
cggagcacacgacgtacacctgcagcagcagccaccacctctcaccctctctctgcagag
atcagctcccttaggatcagcgtgatctaccacacagaaagcatgctgcagttcaagatc
tatgatcccactaataaaaggtacgaggtcccagtgcctctgaacatcccttcctctcct
gttggctcacctgaaaaccgtctgtatgatgtcaggattcaaaacaatcctttcgggatc
cagattcaacgaaagaactccagcactgtgatttgggattctcagctcccaggcttcacc
ttcaatgacatgttcctttccatttctactcgcctcccctctgagaacatctatggcttc
ggagaaactgagcacacaacttttagaagaaacattagctggaacacatggggaatattt
tctcgagatgagccaccagggtacaagaagaattcctatggtgtccacccctactacatg
ggactggaggaggatggcaatgcccatggagtgcttctgctaaacagtaatgccatggat
gtgacattgcagcctactcctgccctgacatatcgcaccacaggagggattttggacttt
tatgtagttttggggccaactcccgagcttgtaacccagcaatacactgagttgattggt
cggccagcaatggtttcatactgggccttgggattccagctgagtcgctatggataccag
aatgatactgaaatctccaatttgtatgatgaaatggtggaagccaatattccctatgat
gttcagcatgtagacatcgattacatggaccggaagctggactttaccctcagcacgagc
tttcaaaaccttagtctgctgatggagcgaatgaagaaaaatggcacaagatttgtcctt
gttctgaatccaggcatttctcgcaacgagaccaactatctcccattcaccacagggcag
gaaaacaatgtattcatcaaatggcctaacagcagtgacattgtctggggagaggtaaga
tgggaggagatgcctctgtacaaagtccacatcgcttatcctgatttcctgcgtaacagc
acagctgcttggtggaaggaggaaataaaaaagctctacacaagcccaaagagcttgaag
tttgatggactgtggatcgataagaatgagccatcaaactttgtggatggatctgtcagt
ggctgccgtgatgaaattcttaataagccaccgtatatgccatatttggagtccagggac
aggggtctcagcagcaagaccctgtgcatggagagtgagcagatcctgcccgacggctcc
cgggtgcggcactacgatgtgcacagcctgtacgggtggtcccagaccagacccacatac
gaagctgtgcaggaggtgacggatcagcgaggggtcgtcattacccgttccacgttcccc
tcttctggccgctgggcaggacactggctgggagacaacacagctgcatgggaccagctg
aggaagtctatcattggcatgatggagttcagtctctttggaataccttatacaggagca
aatatctgtggattcttgggaaatgctgaatatgagatgtgtcttcgctggatgcaactg
ggggcgttttatccattttccaggaaccacaacaccatcgggacaaggagacaagatcct
gtggcctggaattcaacctttcagatgtactcaaaaaaagtcctccagaccagatacacc
ctgctgccttacctctatactctgatgcacaaagctcacgttgagggcagcactgttgtc
cgccctctcctccatgagtttagagaagataggacaacgtgggatatagaccgtcagttc
atgctgggccctgccgtcttaatcagccccgtgctgacaagtaatacttttgaggtccat
gcttatttccccagagcccgttggtatgactatagcatggaatctggcaatacatcgaca
ggtgagtggagaatcctggaggctccccttgaccacatcaaccttcatatcagaggaggc
tacatcttgccttggcaggaggttgcaatgaacactcactccagtcgacaactatttatg
ggattgattgttgctttggatgacaatgggaaagctgaaggtcagatgttctgggatgat
ggacaaagcattgtttcatattttaagctcttatatttagtagcaagatacagtgtaatt
gaaaacatattgcaaatccagaccatgcacaataagtatttgaatgattcaaatcaactg
aaagttggatatattaaaatctgggggatccattctactgatgtgacacaagtcaatgtc
acctataacaacaagcaattcacaacaatgaatttcacgagtgacccctacaatcagaca
ctaactattcaactgattaacaagattttcaggctggaaaagttaactgaggtcacttgg
agtcacaatgttcccaacgttacttctacaccaatgacgagtaccttctcatcaacatct
ccagatcctacatctactattattgctaccatttctgagtctattgtcactagttctgct
agcaatagtactgcctctcctattataaccacttctttcccaacaaatagcaatgctact
agcactaataatacgcttccgattacaatgattccttctcttacaaatactgagactgat
actactagcatggattcagttactacaaatgttttaaatactaccactgctagaaacaca
aaaacaactacagctatcacaacacttactttaataacaaatgctacttctgaacaacct
actactgtgatcatgtcaactctacctcctacaggcacccttggtatcaccaccacagat
aatgtactgaccagaatcagtaccactacttatcctccagatacccctacccatgcttta
agtaccacatccaggagcactcaaagcaccaccaataccaatattaccaatatgacaact
ggtgttactgacattataaatacttccactgctacttcctcacatatgaacattacagat
attaaatctactactaaagttgctggaaatgccgtcacagcgtatactaccaccatcact
acatctgttttcagcacaaaaactataaattcaaacactacttctgacaccatctttaca
aatacttacattccaagtaccacagctattcccaccaccaatacttcgaagattacagag
cattcagaaaatattgctgatgcagataactccaggcgtgtttttattccaaatactata
gtagcctcagattcactaacaccttttctggatacagcaactcaccatcatgtaacaaca
aattctacaaccagttttttacctcttattgtaactaatgctaccacggctattacgaat
gttaccatttatgcttcaaatactattattcctgatagaacaccaatggatgcctctact
actgcattgacttatattgcaaacaccaaaaatactactgtagttccctga

DBGET integrated database retrieval system