KEGG   Myotis davidii: 102758798Help
Entry
102758798         CDS       T02992                                 

Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
myd  Myotis davidii
Pathway
myd05034  Alcoholism
myd05165  Human papillomavirus infection
myd05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:myd00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102758798
  Substance dependence
   05034 Alcoholism
    102758798
  Infectious diseases
   05165 Human papillomavirus infection
    102758798
Enzymes [BR:myd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102758798
Chromosome and associated proteins [BR:myd03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102758798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102758798
NCBI-ProteinID: XP_006758080
LinkDB All DBs
Position
Un
AA seq 377 aa AA seqDB search
MEEPEEPVDSGQSLPPVYIYSPEYVSMCDSLAKVPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQMVSREGDDDHPDSTEYGLGYDCPATEGIFDYAAAVGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDVVLGILRLRRKFDRVLYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDERY
YHICESVLKEVYMAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGRCLKYILQWQLATLV
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RVQQILSYIKGNLKHVV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccagaggaacctgtggacagtgggcagtcactgcccccagtttacatctac
agtcccgagtatgtcagcatgtgcgattccctggccaaggtccccaaacgggccagtatg
gtacattctttgattgaagcatatgcactgcacaagcaaatgaggatagttaagcccaaa
gtggcctccatggaggagatggccaccttccacacggatgcctatctgcagcacctccag
atggtcagccgagaaggagatgacgatcatccggattctacggagtatggcctgggctat
gactgtccagctaccgaagggatatttgactacgcggcagctgtgggaggggctacgatc
acagctgcccagtgcctgattgatggaatgtgcaaagtagccattaactggtccggaggg
tggcatcacgcaaagaaagacgaagcgtctgggttttgttatctcaatgatgttgtcctg
ggaatattacgattgcgacggaaatttgaccgtgttctctatgtggatttggatctgcac
catggagatggtgtagaagatgccttcagtttcacctccaaagtcatgaccgtgtccctg
cacaaattctccccggggtttttcccaggaacaggtgatgtgtctgatgttggcctaggg
aagggacggtactacagtgtgaatgtgcccattcaagatggcatacaggatgagaggtat
taccacatctgtgaaagtgtactgaaggaggtgtacatggcctttaaccccaaagcggtg
gtcttacagctgggagctgatacaatagctggggatccgatgtgctcctttaacatgact
ccggtgggaattggcaggtgccttaagtacatccttcagtggcagttggcaacgctcgtt
ttgggaggaggaggctataaccttgccaacacagctcgatgctggacatacttgactggg
gtcatcctcgggaaaacactctcctctgagatcccagatcatgagtttttcacagcatat
ggtcctgattatgtgctggaaatcacgccaagctgccggccagaccgcaatgagccccac
cgagtccagcaaatcctcagctacatcaaagggaatctgaagcatgtggtctag

DBGET integrated database retrieval system