KEGG   Myotis davidii: 102759072Help
Entry
102759072         CDS       T02992                                 

Gene name
NOTCH1
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
myd  Myotis davidii
Pathway
myd01522  Endocrine resistance
myd04330  Notch signaling pathway
myd04658  Th1 and Th2 cell differentiation
myd04919  Thyroid hormone signaling pathway
myd05020  Prion diseases
myd05165  Human papillomavirus infection
myd05200  Pathways in cancer
myd05206  MicroRNAs in cancer
myd05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102759072 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102759072 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102759072 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102759072 (NOTCH1)
   05206 MicroRNAs in cancer
    102759072 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    102759072 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    102759072 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102759072 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102759072 (NOTCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Ank_2 DUF3454 Ank_5 Ank Ank_3 EGF_2 Ank_4 EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 102759072
NCBI-ProteinID: XP_015427846
LinkDB All DBs
Position
Un
AA seq 1543 aa AA seqDB search
MGCSDSAAGALLAGGAAGLAAVAFSHDRGSQVWPPPSAAPSKNVFEQQDNPGAWIGAPAQ
PGSPVKTGGGAEFGIVPRALSALSTALQAAFQAALPRSERACCTCRLLPPSFQLPGQDIE
APWGSRLRCSQPSETCLNGGKCEVFPNGTEIHSEVERKPVLRGLPLGGAALAVKDQTGVG
PRHVQVCKAQGPGPGYRDFPGDEVKRCPRPEKKRLLGVGAAIGWPLPQPCGLLSESATGG
LRKAGALLDVTCGSPVFSSETGRVHLQDASRQDGCKSPTGSAGKTCQQADPCASNPCANG
GQCLPFEASYICRCPPDPGALPTGFTGQNCEENVDDCPGNSCQNGGSCVDGVNTYNCRCP
PEWTGQYCTKDMDECQLMPNACQNGYRVASFYCECPHGRTGLLCHLNDACISNPCNEGSN
CDTNPVNGKAICTCPSGYMGPACSQDVDECSLGANPCEHKGKCINTLGSFECRCLQGYTG
PRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYTGPHCEVDIDECDPDPCHYGSCKD
GVAAFTCLCRPGYTGHHCETNINECHSQPCRHGGTCQDRDNAYLCLCLKGTTGPNCEINL
DDCASNPCDAGTCLDKIDGYECACEPGYTGERCWGSGAPPSSIPQSPAHGLALGPNCQTN
INECASNPCLNQGTCIGPCRNGGECRASEDYESFSCVCPAGWQGQTCEVDINECVKSPCR
HGASCQNTNGGYRCHCQAGYTGRNSPLRMSCKEGRGKGGGVMGFVSLRPPVLCQGLPEAA
VGLREVRQAAAGPVCPSGPRGHGLSQRGRSYAPVTLRRLPTCSSCFNGGTCVDGIDSFTC
LCPPGFTGSYCEHDINECDSRPCLHGGTCQDSYGTYKCTCPLGYTGLNCQNLVRWCDSSP
CKNGGKCSQTNVLYRCECHSGWTGLYCDVPSVSCEAAARERGNRVTXXXXXXGLCMDADN
THHCRCQPGYTGSYCEDQVDECSPSPCQNGATCTDYPGGYSCECVAGYHGVNCSEEINEC
LSHPCQNGGTCIDLTNTYKCSCPRGTQAQRERGRSARANPSLRSGKGKKRRNYQGASLHN
QTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIR
NRATDLDARLHDGTTPLILAARLVVEGMLEDLINSHADVNALDDLGKSALHWATSVNTVE
AALVLLKNGANKDMQNNKVETPLFLAACEGSYEMAKVLLDHFANWDITDHMDRLPRDIAQ
ERMHHDIVRLLDEHSLVHSPPLHGALGGAPTLSPPLCSPNGYLGNLKPAVPGKKARKPST
KAFAGRGHSENSHGACDPTKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEHSLVRSPPLHGALGGAPTLSPPLCSPNGYLGNLKPAVPGKKALAA
HTILPQDSQALPTALPSSLGPPMATAQFLTPPSQHSCSSSPVDNTPSHQLQVPEHPFLTP
SPESPDQWSSSSPHSNISDWSEGISSPPTSTQSQIAHIPEAFK
NT seq 4632 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctctgattccgcggcgggcgcgttgttggcgggcggggcggctggccttgca
gctgtcgcattttcccacgatcgggggagccaagtgtggccaccccccagcgctgccccc
tcgaagaacgtgtttgaacagcaagacaatcctggtgcctggataggggccccagcccag
cccggctccccagtgaagacgggtgggggtgcggagtttgggatcgtgcccagggccctc
tcggctctctccactgctctccaggcggcgtttcaggccgccctgccccgctccgagcgt
gcctgctgcacctgccggctcctcccgccctcattccagcttcctgggcaggacattgaa
gccccttggggttcacgcctgcgatgttcccagcccagcgagacctgcttgaatggcggg
aagtgtgaagtgttccccaacggcacggagatccactcggaagtggagcggaagccggtc
ctcaggggcctgcctctgggcggggccgcgttggcggtgaaggaccagaccggggtcggc
ccccgccacgtccaggtgtgcaaagcccaggggccgggaccaggttaccgtgacttccca
ggggacgaggtgaagcgttgccctcgccccgagaagaagcggctgcttggcgtgggtgct
gccatcgggtggcccctcccccaaccttgtggactcctctcggagtctgccacggggggc
ttgaggaaggcaggcgcgctgctggacgtaacctgcgggagccccgttttctcatcggaa
acgggccgggtgcacctgcaggacgcgtcccggcaggacggctgcaagagcccgacggga
agtgcagggaagacgtgccagcaggcggacccgtgcgcctccaacccctgtgccaatggc
ggccagtgcctgcccttcgaggcctcctacatctgccgctgcccaccggacccgggcgct
ctccccacaggcttcaccggccagaactgcgaggagaacgtcgatgactgtccagggaac
agctgccagaacgggggcagctgcgtggacggcgtgaacacctacaactgccgctgcccg
cccgagtggacaggtcagtactgcaccaaggacatggacgagtgccagctcatgcccaat
gcctgccagaatggctaccgcgtggcttccttctactgcgagtgtccccacggccgcacg
ggtctgctgtgccacctcaacgacgcctgcatcagcaacccctgcaacgagggctccaac
tgcgacaccaaccccgtcaacggcaaggccatctgcacctgcccctcggggtacatgggg
ccggcctgcagccaggacgtggacgagtgctcactgggtgccaacccctgtgagcacaag
ggcaagtgcatcaacacgctgggctccttcgagtgccggtgcctgcagggctacaccggc
ccacgctgcgagatcgacgtcaatgagtgcgtctcgaacccgtgtcagaatgacgccacc
tgcctggaccagatcggggagttccagtgcatctgcatgcccggctacacggggccccac
tgcgaggtggacatcgacgagtgtgaccccgacccctgccactacgggtcctgcaaggac
ggcgtggccgccttcacctgcctgtgccggcccggctacacgggccaccactgcgagacc
aacatcaacgaatgccacagccagccctgccgccacgggggcacctgccaggaccgcgac
aacgcctacctctgcctctgcctcaaggggaccacaggacccaactgtgagatcaacctg
gatgactgtgccagcaacccctgcgacgcgggcacgtgcctggacaagatcgacggctat
gagtgcgcctgcgagccaggctacacgggtgagcggtgctgggggtcaggggcccccccc
agctccatcccgcagagccctgctcatggcctggccttgggccccaactgccagaccaac
atcaacgagtgtgcgtccaacccgtgtctgaaccagggcacctgcatcggcccctgcagg
aacggcggcgagtgcagggcgtccgaggactacgagagcttctcctgcgtgtgcccggcc
ggctggcaggggcagacctgcgaggtggacatcaacgagtgcgtgaagagcccgtgccgc
cacggcgcctcctgccagaacaccaacggcggctaccgctgccactgccaggcgggctac
acggggcgcaactctcccctcaggatgagctgtaaggaaggcagaggaaaaggagggggt
gtaatggggtttgtgagtctgaggcccccagtcctgtgtcaggggctccctgaggctgcc
gtgggcctccgtgaggttcgtcaggctgctgctggcccggtgtgtccgtcaggcccccgt
ggccacggtctaagccagcgtggcaggtcctacgccccagtcaccctccggcgcctgccc
acctgcagctcctgcttcaatggcggcacctgcgtggatggcatcgactccttcacctgc
ctgtgcccgcctggcttcacgggcagctactgtgagcacgacatcaacgagtgcgactcg
cggccctgcctgcacggcggcacctgccaggacagctacggcacctacaagtgcacctgc
ccgctgggctacaccggcctcaactgccagaacctggtgcgctggtgtgactcctcgccc
tgcaagaacggcggcaagtgctcgcagaccaacgtcctgtaccgctgcgagtgccacagc
ggctggaccggcctctactgcgacgtgcccagcgtgtcctgcgaggcagccgcccgggag
cgaggtaaccgcgtgacnnnnnnnnnnnnnnnnngcgggctctgcatggacgcggacaac
acgcaccactgccgctgccagccgggctacacgggcagctactgcgaggaccaggtggac
gagtgctcgcccagcccctgccagaacggggccacctgcaccgactaccccggcggctac
tcctgcgagtgcgtggccggctaccacggggtgaactgctccgaggagatcaacgagtgc
ctgtcccacccgtgccagaacggcggcacatgcatcgacctcaccaacacctacaagtgc
tcctgtccccggggcacacaggctcagcgtgagcgcggccgatccgcgcgggctaatccc
tccttgaggagcggaaaaggaaagaaaaggaggaattaccagggcgccagcctgcacaac
cagaccgaccgcaccggcgagacggccctgcacctggccgcccgctactcccgctccgac
gcggccaagcgcctgctggaggccagcgctgacgccaatatccaggacaacatgggccgc
acccccctgcacgcagccgtgtccgccgatgcacagggcgtcttccagatcctgatccgg
aaccgagccacggacctggacgcccgcttgcacgacggcaccacgccgctgatcctggct
gcgcgcctggtggtggagggcatgctggaggacctcatcaactcgcacgccgacgtcaac
gccttggacgacctgggcaagtccgccctgcactgggccacctccgtgaataccgtggag
gccgcactggtgctcctgaaaaacggggccaacaaggacatgcagaacaacaaggtggag
acgcccctgttcctggctgcctgtgagggcagctatgagatggccaaggtgctgctggac
cacttcgccaactgggacatcacggaccacatggaccggctgccgcgggacatcgcacag
gagcgcatgcaccatgacatcgtgcggctgctggacgagcacagcctggtgcacagcccc
ccgctgcacggcgccctgggcggcgcgcccaccctgtcgcccccgctctgctcgcccaac
ggctacctgggcaacctcaagccggccgtgccgggcaagaaggcacgcaagcccagcacc
aaggctttcgcggggagaggccacagtgagaattcccacggggcctgtgaccccacaaag
gaggagacgcccctgttcctggccgcccgcgagggcagctacgagacggccaaggtgctg
ctggaccacttcgccaatcgggacatcacggaccacatggaccggctgccgcgggacatc
gcacaggagcgcatgcaccacgacatcgtgcggctgctggacgagcacagcctggtgcgc
agccccccgctgcacggcgccctgggcggcgcgcccaccctgtcgcccccgctctgctcg
cccaacggctacctgggcaacctcaagccggccgtgccgggcaagaaggcactggcggcg
cacaccatcctgccccaggacagccaggccctgcccacggcgctgccgtcctcgctgggc
ccgcccatggccaccgcccagttcctgacgccgccctcccagcacagctgctcctcctcg
cccgtggacaacacccccagccaccagctgcaggtgcccgagcaccccttcctcaccccg
tcccccgagtcccccgaccagtggtccagctcgtccccccactccaacatctccgattgg
tccgagggcatctccagcccgcccaccagcacgcagtcccagatcgcccacatcccggag
gcgttcaagtaa

DBGET integrated database retrieval system