KEGG   Myotis davidii: 102759793
Entry
102759793         CDS       T02992                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
myd  Myotis davidii
Pathway
myd01522  Endocrine resistance
myd04068  FoxO signaling pathway
myd04110  Cell cycle
myd04115  p53 signaling pathway
myd04151  PI3K-Akt signaling pathway
myd04152  AMPK signaling pathway
myd04218  Cellular senescence
myd04310  Wnt signaling pathway
myd04340  Hedgehog signaling pathway
myd04371  Apelin signaling pathway
myd04390  Hippo signaling pathway
myd04510  Focal adhesion
myd04530  Tight junction
myd04630  JAK-STAT signaling pathway
myd04917  Prolactin signaling pathway
myd04919  Thyroid hormone signaling pathway
myd04921  Oxytocin signaling pathway
myd04933  AGE-RAGE signaling pathway in diabetic complications
myd04934  Cushing syndrome
myd05160  Hepatitis C
myd05162  Measles
myd05163  Human cytomegalovirus infection
myd05165  Human papillomavirus infection
myd05166  Human T-cell leukemia virus 1 infection
myd05167  Kaposi sarcoma-associated herpesvirus infection
myd05169  Epstein-Barr virus infection
myd05200  Pathways in cancer
myd05203  Viral carcinogenesis
myd05205  Proteoglycans in cancer
myd05206  MicroRNAs in cancer
myd05210  Colorectal cancer
myd05212  Pancreatic cancer
myd05213  Endometrial cancer
myd05214  Glioma
myd05215  Prostate cancer
myd05216  Thyroid cancer
myd05218  Melanoma
myd05219  Bladder cancer
myd05220  Chronic myeloid leukemia
myd05221  Acute myeloid leukemia
myd05222  Small cell lung cancer
myd05223  Non-small cell lung cancer
myd05224  Breast cancer
myd05225  Hepatocellular carcinoma
myd05226  Gastric cancer
myd05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102759793 (CCND1)
   04340 Hedgehog signaling pathway
    102759793 (CCND1)
   04390 Hippo signaling pathway
    102759793 (CCND1)
   04371 Apelin signaling pathway
    102759793 (CCND1)
   04630 JAK-STAT signaling pathway
    102759793 (CCND1)
   04068 FoxO signaling pathway
    102759793 (CCND1)
   04151 PI3K-Akt signaling pathway
    102759793 (CCND1)
   04152 AMPK signaling pathway
    102759793 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102759793 (CCND1)
   04115 p53 signaling pathway
    102759793 (CCND1)
   04218 Cellular senescence
    102759793 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102759793 (CCND1)
   04530 Tight junction
    102759793 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102759793 (CCND1)
   04921 Oxytocin signaling pathway
    102759793 (CCND1)
   04919 Thyroid hormone signaling pathway
    102759793 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102759793 (CCND1)
   05206 MicroRNAs in cancer
    102759793 (CCND1)
   05205 Proteoglycans in cancer
    102759793 (CCND1)
   05203 Viral carcinogenesis
    102759793 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102759793 (CCND1)
   05212 Pancreatic cancer
    102759793 (CCND1)
   05225 Hepatocellular carcinoma
    102759793 (CCND1)
   05226 Gastric cancer
    102759793 (CCND1)
   05214 Glioma
    102759793 (CCND1)
   05216 Thyroid cancer
    102759793 (CCND1)
   05221 Acute myeloid leukemia
    102759793 (CCND1)
   05220 Chronic myeloid leukemia
    102759793 (CCND1)
   05218 Melanoma
    102759793 (CCND1)
   05219 Bladder cancer
    102759793 (CCND1)
   05215 Prostate cancer
    102759793 (CCND1)
   05213 Endometrial cancer
    102759793 (CCND1)
   05224 Breast cancer
    102759793 (CCND1)
   05222 Small cell lung cancer
    102759793 (CCND1)
   05223 Non-small cell lung cancer
    102759793 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102759793 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102759793 (CCND1)
   04934 Cushing syndrome
    102759793 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102759793 (CCND1)
   05162 Measles
    102759793 (CCND1)
   05160 Hepatitis C
    102759793 (CCND1)
   05163 Human cytomegalovirus infection
    102759793 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102759793 (CCND1)
   05169 Epstein-Barr virus infection
    102759793 (CCND1)
   05165 Human papillomavirus infection
    102759793 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102759793 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102759793
NCBI-ProteinID: XP_006771541
LinkDB
Position
Un
AA seq 296 aa
MAHQLLCCEVDTIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEQVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKGRLQLLGATCMFVASKMKETIPL
TAEKLCIYTDNSIQPEELLHMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEVNKQIIR
KHAQTFVALCATDVKFISNPPSMVAAGSVVAAAQGLHLGSSNSFLSYHRLTRFLSKVIKC
DPDCLRACQEQIEALLESSLRQAQQSLDPKAVEEEEEEEEEVDLACTPTDVRDVDI
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgaggtggacaccatccgccgggcgtaccccgatgcc
aacctcctgaacgaccgggtgctccgggccatgctcaaggcagaggagacctgcgcgccc
tctgtgtcctacttcaagtgtgtgcagaaggagatcctgccatccatgcggaagatcgtg
gccacctggatgctggagcaggtctgcgaggagcagaagtgcgaggaggaggtgttcccg
ctggcgatgaactacctggaccgctttctgtcgctggagcccgtgaagaagggccgcctg
cagctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctg
acggcggagaagttgtgcatctacaccgacaactccatccagcccgaggagctgctgcac
atggagctgctgctagtgaacaagctcaagtggaacctggcggccatgaccccccacgat
ttcattgaacacttcctctccaagatgccggtggccgaggtcaacaagcagatcatccgc
aaacacgcccagacatttgtcgccctctgtgccacagacgtgaagttcatttccaacccg
ccctccatggtggctgccgggagcgtggtggccgcagcgcaaggcctgcacctgggaagc
tccaacagcttcctgtcctatcaccgcctcacgcgattcctctccaaagtgatcaagtgc
gacccagactgcctccgggcctgccaggagcagatcgaagccctgctggagtccagcctg
cgccaggcccagcagagcctggaccccaaggccgtggaggaggaggaagaggaggaggag
gaggtggacctggcctgcacacccaccgacgtgcgcgatgtggacatctga

DBGET integrated database retrieval system