KEGG   Myotis davidii: 102759831Help
Entry
102759831         CDS       T02992                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
myd  Myotis davidii
Pathway
myd00480  Glutathione metabolism
myd00980  Metabolism of xenobiotics by cytochrome P450
myd00982  Drug metabolism - cytochrome P450
myd00983  Drug metabolism - other enzymes
myd01524  Platinum drug resistance
myd05200  Pathways in cancer
myd05204  Chemical carcinogenesis
myd05225  Hepatocellular carcinoma
myd05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102759831 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102759831 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    102759831 (GSTO1)
   00983 Drug metabolism - other enzymes
    102759831 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    102759831 (GSTO1)
   05204 Chemical carcinogenesis
    102759831 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    102759831 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102759831 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    102759831 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:myd02000]
    102759831 (GSTO1)
Enzymes [BR:myd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102759831 (GSTO1)
Transporters [BR:myd02000]
 Other Transporters
  Pores ion channels [TC:1]
   102759831 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_C_3 GST_C GST_N GST_N_2 GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 102759831
NCBI-ProteinID: XP_006756714
LinkDB All DBs
Position
Un
AA seq 211 aa AA seqDB search
MEAQKISFSSLSCYVSFRHEVVNINLKNKPEWFFKKNPAGLVPVLENSRGQLICESAITC
EYLDEAYPEKKLLPADPYEKACQKMVFELFSKVPPLVGRFTRSKNKEDCSDLKEEFRQEF
SKLEEVLTNKKTTFFGGNSLSMIDYLIWPWFERLEALELNECIDHTPKLKLWMAAMRKDP
TVSALLTDVKTFQGFLNLYLQNSLEACDYGL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggaagcacaaaaaatttcattctcttcattgtcttgctatgtgtctttcaggcacgaa
gtcgtcaacatcaacctgaaaaataaacctgagtggttctttaagaagaatcccgctggt
ctggtgccagttctggaaaacagccggggtcaactgatctgcgaatctgccatcacttgt
gagtacctggatgaagcatatccagagaagaagctgttgccagctgacccctatgagaaa
gcgtgccaaaagatggtctttgagttattttctaaggtgccacctttggtaggaaggttt
acgagaagtaaaaataaggaagactgctctgacttgaaagaagaatttcgccaagaattc
agcaagcttgaggaggttctgaccaataagaagacaaccttctttggtggcaattcactt
tctatgattgattacctcatctggccctggtttgaacgactggaagcattggagttaaat
gagtgtatagaccacactccaaaacttaagctctggatggcagccatgaggaaagatccc
acagtatcagctctcctcactgacgtgaaaaccttccaaggtttcttaaatctctacttg
cagaacagcttggaggcctgtgactacgggctctga

DBGET integrated database retrieval system