KEGG   Myotis davidii: 102760573
Entry
102760573         CDS       T02992                                 

Gene name
NLRP4
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:myd04131]
    102760573 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:myd04054]
    102760573 (NLRP4)
Membrane trafficking [BR:myd04131]
 Autophagy
  Other autophagy associated proteins
   Others
    102760573 (NLRP4)
Pattern recognition receptors [BR:myd04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   102760573 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA_25 AAA_22 VirE SRP54 AAA_14 NTPase_1 AAA_28 AAA_30 DAP3 NB-ARC AAA_29 AAA_18 AAA_7 RsgA_GTPase T2SSE
Other DBs
NCBI-GeneID: 102760573
NCBI-ProteinID: XP_015424300
LinkDB
Position
Un
AA seq 979 aa
MASSFFSEFGLLWYLKELSRXXXXXXXVXHFKEKLKQETLHLGLQQIPWANVKKATREVL
ATLLVKHYKETQAWDVTFTIFQKINREDLCQKAKKECTGYTKTYRAHVKEKFSEAWFRDT
VMHCYGHVDKELTQKEHKCLEFLFAPKEPMRRTVILTGAQGVGKTTLLAKLMLAWAEDTL
YQQKFSYVFYLCCREVRQVTATSLAALICRDWSDSLSPIAEITSEPERLLFILDGFEELM
YDLNEPESDLCSDWMAQRPLQVVLSSLLRKKMLPESSLLVAMVPGYTRFIKDRLGHPRIQ
RLLGFTEDEMLLSFSCMFRKGWRGVKAFHFIRSNKQLFSMCQIPVLCWAACTCLKQEMER
GKDLAMTCRRTTSLYSSFVLNLFTPKGAPCPDEQSRVRLKGLCSLAAEGMWSNTFVFGEE
DLRRNGLADSDIPALLDIKALRKSGGTKNASYTFLHLCIQEVCAALFYFIKNHTDHPIPA
AGCAEVVLETHLKRTKAQWIFLPSFLFGLLNEKEQRKLCAFFGAHLCQEQVRQAVEQHLW
GISQSEHLRGQLNFLMLCYCLFEMEDEAFVRWAVDLFQEVSFLITDLMDLIVLAYCLTRC
SALRKLDFSIQNVFNFSCLIPSRTGYQLLYWNNICSVLTANENLGELRVSDSNLPGPALV
TLSNHLKHPRCRLQKLKMNNVSFSAESWFFFEVFTQSPVLKHLDLSDTRISHDDFKLLCI
ALNNPACNIEKLLLVGCGLLADDCEGFKEVLMRNTKLKVLDLSYNYLGNGLSLLCEALCL
PACALQGLGLVDCRLREPCWEHLRDVVLGNRNLTHLDLGTNGLKDKDLNLLSEALKQPSC
YLKSLSLFNCLITANGCQDLASILTGNPNLRNLQIGHNNIEDDGVRLLCEALLHPNCHLE
NLGLDACRLTSACCEDLASVLTGSRCLKELNLAGNPLDRCGVLLLCAALRLKKAEFDEET
QELLVAEEERNPCLTITHQ
NT seq 2940 nt   +upstreamnt  +downstreamnt
atggcatcatctttcttttctgaatttggccttctgtggtacctgaaggagctcagcagg
nnnnnnnnnnnnnnnnnnnnagtttaacattttaaggagaagctcaagcaagaaactctg
cacctgggactccagcagatcccctgggctaatgtgaagaaggcaacccgggaagtcctg
gcaaccctgctggtcaagcattataaggaaacacaagcctgggatgtgaccttcaccatc
ttccagaagatcaaccgggaggacctctgccagaaggccaagaaggagtgtacaggatac
acgaagacgtatcgtgctcatgtcaaggagaaattcagcgaggcgtggttccgagacact
gtcatgcattgttatggacacgttgacaaggagctcacccagaaagagcataaatgccta
gagtttctttttgctcccaaggagcccatgagacgcacggtgatccttacaggagctcag
ggggttgggaagaccactctcctggcaaagctgatgctggcctgggcagaggacacgctc
taccagcagaagttctcctacgtattctacctctgctgccgggaggtgaggcaggtgacc
gcgaccagcttggccgccttgatctgtagagactggtccgactccctctctcccatcgcg
gagatcacctctgaaccagagaggctcttgttcatcctcgacggctttgaagagttgatg
tatgacttgaatgagcccgagtcggatctgtgcagtgattggatggctcagaggcccctc
caggtggtcctgagcagcctgctgaggaagaagatgctcccagagtcctccctgctcgtg
gccatggtgcccgggtacacacggttcatcaaggacaggctggggcacccaaggatccaa
aggctcctgggattcacggaagacgagatgctgctgagtttcagctgcatgttccggaag
gggtggagaggcgtcaaagccttccatttcatcagaagcaacaagcagctgttttccatg
tgccagatccccgtcctgtgctgggccgcgtgcacttgtctgaagcaggagatggaacga
gggaaagacctggcgatgacctgccgacggaccacctcgctgtattcctcgtttgtcttg
aacctgttcacgcccaagggggctccctgtccggatgagcaaagccgagtccggctgaag
ggcttgtgttccctggctgccgagggcatgtggagcaacacgtttgtgttcggggaggag
gatctccggagaaacgggttggcggactctgacatccctgcactgctggacatcaaggcc
cttcgcaagagcgggggcaccaagaacgcttcctacacgttcctccacttgtgcatccag
gaggtctgcgccgccctgttctacttcatcaagaaccacaccgaccacccgatcccggcg
gcgggctgtgccgaggtggtgctggagacccatttgaagagaaccaaggcccagtggatc
tttctgccgtctttcctgtttggccttttgaacgaaaaggaacagcggaagctgtgtgcc
ttctttggcgcccacctgtgccaggagcaggtacggcaggcagttgagcagcacctatgg
ggcatcagccagagtgagcaccttcgggggcagctgaatttcctgatgttgtgttactgt
ctgttcgagatggaggacgaggcctttgtgcggtgggcggtggacctgttccaagaggtg
tcctttctgatcaccgacctgatggacttgatagtcctggcctactgcttgacacgctgt
tcggccttgaggaaacttgacttttccatccaaaatgtcttcaacttttcctgtctcatt
ccttccaggacaggttaccagttactctattggaataacatctgctccgtcctcacggcg
aatgagaacctcggagaactccgagtgagtgacagtaacctccctgggccggccctcgta
acactgagcaatcatctgaagcaccccaggtgtcgccttcagaagcttaagatgaataac
gtttccttctccgctgaaagctggtttttctttgaggtgttcactcagagcccggtttta
aaacacctggatctcagtgacacaagaatctcccatgatgacttcaagttgctgtgtatt
gccttgaacaatcccgcgtgcaacatagagaagttactgctggtggggtgtggcctctta
gcggatgattgtgaaggattcaaggaggtcctgatgaggaacacaaagctaaaggttctg
gacttatcctacaactacttgggcaatgggctgtccctcttgtgtgaagccctgtgcctc
ccagcttgtgctctgcagggcttggggttagttgactgccgcctcagggaaccttgctgg
gaacacctccgtgacgttgtcctgggtaacaggaacttgacccacctagaccttggcaca
aatggcctgaaagacaaagacttgaaccttctcagtgaggccttgaaacagccatcctgc
tacctgaagtcactaagtttgttcaactgtctcataactgccaatggctgtcaggacctc
gcctccatcctcacgggaaacccaaacctgagaaatctgcaaatcgggcacaacaacata
gaagatgatggtgtgcggctgctgtgcgaagctctgctgcatcccaactgccacttagag
aatcttgggctggacgcgtgccggttgaccagcgcctgctgtgaggacctcgcttctgtt
ctcacgggaagccgatgcctgaaagaactcaacctggctgggaaccccttggaccgctgc
ggggtgctactgctgtgcgccgccctgaggctgaagaaagctgaatttgatgaggaaacc
caggaactcctggtggctgaggaagagagaaacccctgcttgaccatcacccatcagtaa

DBGET integrated database retrieval system