KEGG   Myotis davidii: 102761006
Entry
102761006         CDS       T02992                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
myd  Myotis davidii
Pathway
myd04015  Rap1 signaling pathway
myd04072  Phospholipase D signaling pathway
myd04080  Neuroactive ligand-receptor interaction
myd04151  PI3K-Akt signaling pathway
myd04810  Regulation of actin cytoskeleton
myd05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102761006 (LPAR2)
   04072 Phospholipase D signaling pathway
    102761006 (LPAR2)
   04151 PI3K-Akt signaling pathway
    102761006 (LPAR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102761006 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102761006 (LPAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102761006 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:myd04030]
    102761006 (LPAR2)
G protein-coupled receptors [BR:myd04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102761006 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srt
Other DBs
NCBI-GeneID: 102761006
NCBI-ProteinID: XP_006778377
LinkDB
Position
Un
AA seq 348 aa
MAQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLIIAAIASNRRF
HQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLQGWFVRQGLLDTSLTASVATLL
AIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSRMAP
LLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLVKTV
VIILGAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMR
RTFRRLLCCQCLRRSTQESAHYTSSTRAGASTRIMLPENGHPLMDSTL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggcccagtgctactacaacgagaccatcggcttcttctacaacaacagcggcaaggag
ctgagctcccactggcggccgaaggacgtggtggtggtggccctgggcctgacggtcagc
gtgctggtgctgctgaccaacctgctgatcatcgcggccatcgcctcgaaccgccgcttc
caccagcccatttactacctgcttggcaacctggctgccgccgacctctttgccggcgtg
gcctacctcttcctcatgtttcacactggcccacgcacagcccggctctcgctccagggc
tggttcgtgcggcagggtctgctggacacaagcctgacggcctcggtggccacgctgctg
gccatcgccgtggagcggcaccgcagcgtgatggccgtgcagctgcacagccgcctgccg
cgtggccgcgtcgtcatgctcattgtgggagtgtgggtggctgcgctgggcctggggctg
ctgcccgcccactcctggcactgcctctgtgccctggacagatgctcacgcatggccccc
ctgctcagccgctcctacctggcggtctgggccctgtccagcctgctcgtcttcctgctc
atggtggctgtctacacccgcatattcttctacgttcgtcggcgggtgcagcgcatggcg
gagcatgtcagctgccacccccgttaccgcgagaccacactcagcctggtcaagactgtt
gtcatcatcctgggggcgttcgtggtttgttggacgccgggccaggtggtgctgctccta
gacggcctggactgcaagtcctgcaacgtcctggccgtggagaagtatttcctcctcttg
gccgaggccaactccctggtcaacgctgtggtgtactcctgccgcgatgccgagatgcgc
cgcaccttccgccgcctcctctgctgtcagtgcctccgccggtccacccaggagtctgcc
cactacacatcctccacccgagccggcgccagcacgcgcatcatgcttcctgagaatggc
cacccgctgatggattccaccctttag

DBGET integrated database retrieval system