KEGG   Myotis davidii: 102761285Help
Entry
102761285         CDS       T02992                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
myd  Myotis davidii
Brite
KEGG Orthology (KO) [BR:myd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102761285 (TGM3)
Enzymes [BR:myd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102761285 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102761285
NCBI-ProteinID: XP_015415718
LinkDB All DBs
Position
Un
AA seq 694 aa AA seqDB search
MADLKPQNIDWQMTANRQAHSTVNYNSQELILRRGQPFRFSLTFNRVLRSGESLGFIAST
GPSPSESAKTKAVFSLSNGTSGGSWYAQLLSQRENTLDISISSPANAPIGWYTLNLQISS
QGNNFTLKLGMLILLFNPWSQADSVFMNNQAERQEYVLEDSGAIFVGSTNRISMIGWNFG
QFEGDILNICLAILDSSLNFRRDPATDVARRGDPKYVGRVLSAMVNSNDDNGVIAGNWSG
SYTGGRDPRNWNGSVEILKEWKKSGFRPVRFGQCWVFAGTLNTVLRCFGIPARVITNFNS
AHDTDRNLSVDVFYDPMGNPLDKGSDSVWNFHVWNESWFVRNDLGPSYNGWQVLDATPQE
RSQGVFQCGPASVTAVREGDVNLDFDMPFIFAEVNADRITWIYDARRNTQKQNSSDTNTI
GRYISTKAVGSYSRMDVTEKYKYPEGSSQERQVFDKAVGKLKPNRTFGPTSSTEVERDER
EPSISGVFKVNGILAVGKEVNLALTLKNLTRDTKTVTVNMTAWTIVYNGTLVHEVWKDSV
TISLDPEEEVQHPVKITYAQYEKYLKADNMIRTTAVCRASDEAEVVVERDVILDNPTLTL
KLMDQARMRKPVNVQMIFSNPLDEPVKNCVLMVEGSGLLLGSLKIDVPNLRPKEQSRVRF
EIMPTRSGTKQLVADFSCNKFPAIKAMLSVDVAV
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggctgatttaaaaccccagaatattgactggcagatgactgccaatcggcaagcgcac
agcacagtcaattacaacagccaggagctcatcttgcgacgaggtcaaccgttccgtttc
tcattgaccttcaaccgagttcttagatctggagaaagtctggggttcatagcctccaca
gggccctccccctcagaatcagccaaaacaaaggctgtgttttcactctccaatgggaca
agtggtggcagctggtatgcacagctcttgtcccagagggagaatactctggacatctcc
atctccagccctgccaatgcacccataggatggtacacgctgaaccttcagatctcctcc
cagggcaacaactttactctgaaacttgggatgttaatactgctctttaacccctggtca
caagcggatagtgtctttatgaataaccaagctgagagacaggagtacgttctggaagat
tctggcgccatatttgtgggaagcacaaatcgaatcagcatgattggctggaacttcgga
cagtttgaaggagacattctgaacatttgcctcgcgatcctggatagcagtctgaatttc
cgccgtgaccctgctactgacgtggcccgcagaggtgaccccaagtacgtcggccgcgtg
ctgagtgcaatggtcaatagcaatgatgacaacggtgtgatagctgggaactggagtggc
agctacaccggtggccgggaccccaggaactggaacggcagtgtggagattctcaaggag
tggaagaagtctggcttcaggccagtccgattcggccagtgctgggtctttgctgggacc
ctcaacacagtgctacggtgttttgggattcccgcccgggtgatcaccaacttcaactca
gctcatgacacagacagaaacctcagcgtggatgtgttctacgaccccatgggaaacccc
ctggacaaaggcagcgatagcgtttggaatttccacgtctggaatgaaagctggttcgtg
cggaatgacctgggcccctcgtacaatggatggcaggttctggacgccaccccccaggag
aggagtcaaggggtgttccagtgcggccccgcttcagtgacagctgtccgagagggcgat
gtgaacctggacttcgacatgcccttcatctttgcggaggttaatgccgaccgcatcacc
tggatctatgatgcccgccgcaacacccagaagcagaactcctcagacacaaataccatt
ggcagatacatcagcacgaaggcggtgggcagctactctcgcatggatgtcaccgaaaag
tacaagtacccagaaggttcaagccaggaaaggcaagtgtttgacaaggcagtggggaaa
ctgaaacccaacagaacatttggcccaacgtcgtcaacagaggtcgaaagagacgaacgg
gagcctagcatctctggggtgttcaaggtcaatggcatcctggcagtgggcaaagaagtc
aacctggccctgacgctcaagaacctgacaagagacacgaagacggtcacggtgaacatg
acggcctggaccatcgtctacaacggcacgcttgtccacgaggtgtggaaggactcggtc
accatctctctggaccctgaagaagaagtccagcatcctgtgaagatcacatatgctcag
tatgaaaagtacctgaaggcggacaacatgatccggaccacagccgtgtgccgggcctcc
gatgaggccgaggtggtggtagagagggacgtcatcctggacaaccccacgctgaccctg
aagctgatggaccaggcgcgcatgcggaagcccgtgaacgtgcagatgatcttctccaac
ccgctggatgagccggtgaagaactgcgtgctgatggtagaggggagcggcctgctgctg
ggcagcctcaagatcgacgtgccgaacctgcgccccaaggagcagtcccgggtacgtttt
gagatcatgcccacgcggagtggcaccaagcagctggtcgctgacttctcctgcaacaag
ttccctgcgatcaaggccatgctgtctgtcgacgtggcagtgtga

DBGET integrated database retrieval system