KEGG   Myotis davidii: 102761943
Entry
102761943         CDS       T02992                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
myd  Myotis davidii
Pathway
myd01521  EGFR tyrosine kinase inhibitor resistance
myd04010  MAPK signaling pathway
myd04014  Ras signaling pathway
myd04015  Rap1 signaling pathway
myd04020  Calcium signaling pathway
myd04072  Phospholipase D signaling pathway
myd04144  Endocytosis
myd04151  PI3K-Akt signaling pathway
myd04510  Focal adhesion
myd04540  Gap junction
myd04630  JAK-STAT signaling pathway
myd04810  Regulation of actin cytoskeleton
myd05163  Human cytomegalovirus infection
myd05200  Pathways in cancer
myd05206  MicroRNAs in cancer
myd05214  Glioma
myd05215  Prostate cancer
myd05218  Melanoma
myd05230  Central carbon metabolism in cancer
myd05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102761943 (PDGFRA)
   04014 Ras signaling pathway
    102761943 (PDGFRA)
   04015 Rap1 signaling pathway
    102761943 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102761943 (PDGFRA)
   04020 Calcium signaling pathway
    102761943 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102761943 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102761943 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102761943 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102761943 (PDGFRA)
   04540 Gap junction
    102761943 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102761943 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102761943 (PDGFRA)
   05206 MicroRNAs in cancer
    102761943 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102761943 (PDGFRA)
   05231 Choline metabolism in cancer
    102761943 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102761943 (PDGFRA)
   05218 Melanoma
    102761943 (PDGFRA)
   05215 Prostate cancer
    102761943 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102761943 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102761943 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myd01001]
    102761943 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:myd04090]
    102761943 (PDGFRA)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102761943 (PDGFRA)
Protein kinases [BR:myd01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102761943 (PDGFRA)
CD molecules [BR:myd04090]
 Proteins
  102761943 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C1-set C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 102761943
NCBI-ProteinID: XP_006757869
LinkDB
Position
Un
AA seq 1102 aa
MTRNGEAWFQFSGAMGTSHLALLVLGCLLAGPSLILCQLSLPSILPNENEKVVQLNSSFS
LRCFGESEVTWQYPMSDEDPNVRIRNEENNSGLFVTVLEVANASAAHTGLYTCYYNHTQT
EENEIEGSHIYIYVPDPDVVFVPLGMTDYLVIVENDDFAIIPCRTTDPQTPVTLLSSDGV
VLADYDSRQGFNGTFSGGPYVCEAIVRGKKFHSIPFNIYSVKATSELDLELEAPKTVYMA
GETIVLTCIVLNNEVVDFQWTYPGEVKNKGVVMLEEIKDPSIKLVHTLMVPKATVKDSGD
YECIARLATREVKEMKKVTIAVHEKGFIEIQPGFSQLEAVNLHEVKHFVVDVQAYPPPRI
SWLKDNLTLIENLTEITTDIEKVQEIRYRSRLKLIRAKEEDSGHYTIVVQNEDDMKSYTF
ELLTQVPASILDLVDDHHGSTGGQTVRCTAAGTPLPEIEWMICKDIKKCNNETSWAILAN
NISNIVTEVYRQDRSRVEGRVTFAKVEETIAVRCLAKNLLGVENRELKLVAPTLRSELTV
AAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWE
FPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKI
MTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDI
FGLNPTDESTRSYVVLSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPAS
YKKKSLLDSEVKNLLSDDNAEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLA
QGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWE
IFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEIYEIMVKCWNSEPEKRPSFYHLR
EIVENLLPGQYKKSYEKVHLDFLKSDHPAVARMRVDADNAYIGVTYKNEEDKLKDWEGGL
DEQRLSADSGYIIPLPDIDPIPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETI
EDIDMMDDIGIDSSDLVEDSFL
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgactcggaatggagaagcttggttccagttttccggagctatggggacttcccatctg
gcactcctggtcctaggctgtctcctcgcagggccgagcctaatcctctgccagctttca
ctcccctctatcctcccaaacgaaaatgaaaaggttgtgcagctgaattcatccttttct
ctgagatgctttggggagagtgaagtgacctggcagtaccccatgtctgacgaggacccc
aatgtgaggatcagaaacgaggagaacaacagtggcctttttgtgacggtgctggaagtg
gccaacgcctcggcggctcacacgggattgtacacttgctattacaaccacacgcagaca
gaggaaaacgagatcgaaggcagtcacatttacatctacgtgccagacccagatgtagtc
ttcgtgcctctgggaatgaccgactatttagtcattgtggagaacgacgattttgccatc
ataccttgtcgcacgactgatcctcagactccggtgaccttgctcagcagtgacggggtg
gtcctcgccgactatgacagccggcagggcttcaacgggaccttctcgggtgggccctat
gtctgcgaggccatcgtcagggggaagaagttccactccattccgtttaacatttattct
gtcaaagcaacatcagaactcgatctagaattggaagcaccaaaaactgtgtacatggca
ggggaaaccattgtgctcacctgcatcgtcctgaacaacgaggtggttgactttcagtgg
acgtacccgggagaagtgaaaaacaaaggcgtcgtaatgctggaggaaatcaaggaccca
tccatcaaactggtgcacaccctgatggtccccaaggccacggtgaaagacagtggagat
tacgaatgtatcgctcgcctggccaccagggaggtcaaagagatgaagaaagtcaccatt
gctgtccacgagaaagggttcattgaaatccaacccggcttcagccagctggaagctgtc
aacctgcatgaagtcaaacattttgtggtggacgtgcaggcctacccgccgcccaggata
tcctggctgaaggacaacctgactctgatcgaaaacctcaccgaaatcaccactgacata
gaaaaggtccaggaaatcaggtaccgaagtagattaaagctgatccgtgctaaggaggaa
gacagtggccattacactattgtagttcaaaatgaagacgacatgaagagctacactttt
gaactcttaactcaagttcccgcatctattctggacttggtcgacgaccaccatggctcc
acagggggacagaccgtgagatgcacagctgcagggacacctcttcctgaaattgagtgg
atgatttgcaaggatattaagaaatgtaataatgagacttcatgggcgattttggccaac
aacatctcaaacatcgtcacggaggtctaccgccaggacaggagtagggtggagggccgg
gtgacgtttgccaaagtggaggagaccattgcggttcgatgtctggctaagaatctcctt
ggtgttgagaaccgagagctgaagctggtggctcccactctgcgttccgagctcacggtg
gcagccgcagtcctggtgctattggtgattgtgatcatctcactgattgtcctggttgtc
atctggaaacagaaaccaaggtatgaaattcgctggagggtcattgaatcaatcagccct
gatggacacgaatatatttatgtggacccgatgcagctgccttatgactcgagatgggag
tttccaagagacggactagtgctgggtcgtatactgggatctggtgcgtttgggaaggtg
gttgaaggaactgcctacggattaagccggtcccaaccggtcatgaaagtagcagtgaag
atgcttaaacccacagccagatccagtgaaaaacaagctctcatgtctgaactgaagata
atgacccacctggggccgcatttaaacattgtcaacctgctgggcgcctgtaccaagtca
ggccccatttacatcatcactgaatactgcttctatggggatttggtcaactacttgcat
aagaatagggacagcttcctgagccaccacccagagaagccaaagaaagagctggacatc
tttggattaaatcctaccgatgaaagcacacggagttatgttgttttatcttttgaaaac
aatggtgactacatggacatgaagcaagctgacaccacacagtacgtccccatgctggaa
aggaaagaggtttctaaatactcggacatccagagatcgctgtatgaccgcccagcctca
tacaagaagaagtctctgttagactcagaagtcaaaaacctcctttcggatgataacgca
gaaggcctgactttgttggatttgttgagcttcacctatcaagttgctcgaggaatggag
tttttggcttcaaagaattgtgtccaccgggacctggccgctcgcaacgtccttctggca
caagggaaaatcgtgaagatctgtgactttggcctggccagagacatcatgcatgactcg
aactacgtatcgaaaggcagcaccttcctccctgtgaagtggatggctcctgagagcatc
ttcgacaacctctacaccacgctgagcgacgtctggtcttacggcattctgctgtgggag
atcttttccctgggtggcacaccctaccctggcatgatggtggattctactttctacaat
aagatcaagagtgggtaccggatggccaagcctgaccacgccaccagtgaaatctatgag
atcatggtgaagtgctggaacagtgagccggagaagagaccctccttttaccacctgaga
gagattgtggagaacctgcttcctggacagtataaaaagagttatgaaaaggttcacctg
gatttcctgaagagcgaccatcctgctgtggcgcgcatgcgagtggatgctgacaacgcc
tacattggcgtcacctacaaaaacgaggaggacaagctgaaggactgggagggtggcctg
gatgagcagaggctgagtgctgacagcggctacatcatccctctgcctgacatcgacccc
attcctgaggaggaagacctgggcaagaggaacagacacagctcgcagacctctgaagag
agtgccattgagacaggttccagcagttccaccttcatcaagagagaggacgagaccatt
gaggacatcgacatgatggatgacattggcatagactcctcagacctggtggaggacagc
ttcctttaa

DBGET integrated database retrieval system