KEGG   Myotis davidii: 102762912
Entry
102762912         CDS       T02992                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
myd  Myotis davidii
Pathway
myd04060  Cytokine-cytokine receptor interaction
myd04066  HIF-1 signaling pathway
myd04151  PI3K-Akt signaling pathway
myd04630  JAK-STAT signaling pathway
myd04640  Hematopoietic cell lineage
myd05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102762912 (EPO)
   04066 HIF-1 signaling pathway
    102762912 (EPO)
   04151 PI3K-Akt signaling pathway
    102762912 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102762912 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102762912 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102762912 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:myd04052]
    102762912 (EPO)
Cytokines and growth factors [BR:myd04052]
 Cytokines
  CSF and other factors
   102762912 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102762912
NCBI-ProteinID: XP_006764777
LinkDB
Position
Un
AA seq 213 aa
MSPHRPCPEGPAPVLMTHLPSFLEGCPASLLLLSLLLLPLGLPVLGAPPRLICDSRVLER
YILEAREAENVTMGCAEGCSFSENITVPDTKVNFYAWKRMAVEQQALEVWQGLALLSEAI
LRGQALLANSSQTSETLQLHVDRAISGLRSLTSLLRALGSQKEAISPPDATASAIPLRTF
TVDTLCKFFRIYSNFLRGKLKLYTGEACRRGDR
NT seq 642 nt   +upstreamnt  +downstreamnt
atgagcccgcaccgcccctgtccagaaggcccagcacctgtgctcatgacccatcttcct
tcctttcttgaaggatgtcctgcctcgctgctcctgctgtccttgctgctgcttcccctg
ggcctcccagtcttgggcgcccccccacgcctcatctgtgacagccgcgtcctggagcgg
tacatcctggaggcccgggaggctgagaatgtcacgatgggctgtgctgaaggctgcagc
ttcagtgagaatatcaccgtcccggacaccaaggttaacttctatgcctggaagaggatg
gcggtggaacagcaggccttggaagtctggcagggcctggctctgctctcagaagccatc
ctgcgcggccaggccctgttggccaactcctcccagacgtctgagaccctgcagctacat
gtggacagagccatcagcggcctgcgcagcctcacctccctgcttcgggcactgggaagc
cagaaggaagccatctcccctccagatgcaacggcctctgctattccactccgaacattc
actgttgatactttgtgcaaatttttccgaatctactccaatttcctgcggggaaagctg
aagctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system