KEGG   Myotis davidii: 102763004Help
Entry
102763004         CDS       T02992                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
myd  Myotis davidii
Pathway
myd00010  Glycolysis / Gluconeogenesis
myd00051  Fructose and mannose metabolism
myd00052  Galactose metabolism
myd00500  Starch and sucrose metabolism
myd00520  Amino sugar and nucleotide sugar metabolism
myd00524  Neomycin, kanamycin and gentamicin biosynthesis
myd01100  Metabolic pathways
myd01200  Carbon metabolism
myd04066  HIF-1 signaling pathway
myd04910  Insulin signaling pathway
myd04930  Type II diabetes mellitus
myd04973  Carbohydrate digestion and absorption
myd05230  Central carbon metabolism in cancer
Module
myd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
myd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102763004 (HK1)
   00051 Fructose and mannose metabolism
    102763004 (HK1)
   00052 Galactose metabolism
    102763004 (HK1)
   00500 Starch and sucrose metabolism
    102763004 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102763004 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102763004 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102763004 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102763004 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102763004 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102763004 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102763004 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:myd04131]
    102763004 (HK1)
Enzymes [BR:myd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102763004 (HK1)
Membrane trafficking [BR:myd04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102763004 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102763004
NCBI-ProteinID: XP_015417588
LinkDB All DBs
Position
Un
AA seq 941 aa AA seqDB search
MAHRLCLRFCVCKEESCSRSGWTPSLPGGGGPKSGIDKYLYAMRLSDETLIDIMTRFKKE
MRHGLSRDFNPTATVKMLPTFVRSTPDGSEKGDFIALDLGGSYFRILRVQVSLEKNQNVH
MESEVYDTPENIMHGNGSQLFDHVAECLGDFMEKKKIKDKKLPVGLTFSFPCRQTRIDEG
ILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEV
GLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRGSL
NPGKQLFEKMISGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFTTSDVSAIERNK
EGLSNAKDILTRLGVEPSDVDCVAVQHVCTIVSFRSANLVAAALGAILNRLRDNKGIPRL
RTTVGVDGSLYKMHPQYSRRFHKTLRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQ
HRQIEETLAHFRLTREMLLEVKKRMRTEMEMGLKKKTNDKAVVKMLPSFVRSTPDGTENG
DFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFL
DYMGIKGPRMPLGFTFSFPCKQMSLDAGILITWTKGFKATDCVGHDVATLLREAVKRREE
FDLDVVAVVNDTVGTMMTCAYEEPTCEIGLIVGTGSNACYMEEMKNVEMLEGNVGRMCIN
MEWGAFGDNGCLDDIRTEYDVLVDENSLNAGKQRCRFPLVTVFILEHPGLPLEFTNKCYF
DGEKPHDLFTGKYSERAPGLLSWVLLCAASCSCSHSDRLALLQVRAILQQLGLNSTCDDS
ILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSRIMH
QTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRNEAGS
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccggctgtgcctcaggttctgcgtctgtaaggaagagtcttgttctagatct
ggatggacgccgagtttgcccggtggcggcggtcctaagtctgggattgacaagtatctc
tatgccatgcggctctccgacgaaactctgatagatatcatgacccgtttcaagaaggag
atgaggcatggtctttcccgggattttaatccgacagccacagtcaagatgttgccaacg
tttgtaaggtccactcctgatggctcagaaaagggagatttcattgccctggaccttggt
gggtcttactttcgaattctgcgggtgcaagtgagcctagagaagaaccagaatgttcac
atggagtccgaggtgtatgacacgccggagaacatcatgcacggcaacggaagccagctt
tttgaccatgtcgctgagtgcctgggagacttcatggagaaaaaaaaaatcaaggacaag
aaattacctgtgggactcacattttctttcccttgtcggcagaccagaatagatgagggc
attctgatcacctggacaaagcgatttaaagcgagcggagtggagggagcggatgtggtg
aagctgcttaacaaagccatcaaaaaacgcggggattatgatgccaacatcgtggctgtg
gtgaatgacacggtggggaccatgatgacttgtggctacgacgaccagcattgtgaagtc
ggcctcatcatcggcaccggcaccaacgcgtgctacatggaggagctgaggcacatcgac
ctggtggaaggcgacgaggggaggatgtgcatcaacaccgagtggggggcctttggggac
gacggggccctggaagacatccgcacggagttcgaccgcgagatagaccgggggtctctc
aacccggggaagcagctgtttgagaagatgatcagtggcatgtacctgggggagctggtt
cgactgatcctggtcaagatggccaaggagggccttttatttgaagggcggatcacccca
gagctgctcaccagagggaagtttaccaccagtgacgtgtcagccattgaaaggaataag
gaaggcctcagcaatgccaaagacatcctgacccgcctgggagtggagccgtccgatgtc
gactgcgtcgccgtccagcacgtgtgcaccatcgtctccttccgctctgccaacctggtg
gctgcggcgctgggcgccatcttgaatcgcctccgagataacaagggcatccccaggctg
cggaccacggttggtgtcgacgggtctctttacaagatgcacccacaatattctcgacgt
ttccacaagaccctgaggcgcctggtgcccgactgcgacgtgcgtttcctcctctcagag
agtggcagcggcaagggggcagccatggtgaccgcggtggcctaccgcctggccgagcag
caccggcagatagaggagaccctggcgcacttccgcctcaccagggagatgttgctggag
gtgaagaagaggatgcggaccgagatggagatggggctgaagaagaagaccaacgataag
gccgtggtgaagatgctgccctccttcgtccgcagcactccggatgggaccgagaatggt
gacttcttggccctggatcttggaggaacgaatttccgcgtcctgctggtgaaaatccgt
agtgggaaaaagaggacggtggagatgcacaacaagatctatgccattcccatcgaaatc
atgcagggcactggggaggagctgtttgaccacatcgtctcctgcatctccgacttcctg
gactacatggggatcaaaggcccccgaatgcctctgggcttcaccttctcgtttccttgc
aagcagatgagcttggatgcgggaatcttgataacctggacgaaggggtttaaggcaacc
gactgtgtggggcacgacgtagccaccttactgcgggaagcagtaaaaaggagagaggaa
tttgatctggacgtggtggctgtggtcaacgacacggtgggcaccatgatgacttgtgct
tatgaggagcccacctgtgagattggactcatcgtagggactggcagcaatgcctgctac
atggaagagatgaagaacgtggagatgctggaggggaacgtggggcggatgtgtatcaac
atggagtggggcgctttcggggacaacgggtgtctggatgatatcagaacagagtatgac
gtcctggtggatgaaaactctctgaatgctgggaaacagaggtgccgcttcccactagtg
accgtgttcatcctggagcatcctggcctccctcttgaatttacaaataaatgttacttc
gatggggaaaagccccatgacctattcacgggtaagtacagtgagcgggctcccgggctg
ctctcgtgggtcctgctttgtgcagcctcctgctcttgttcccacagtgaccgcttggcg
ctgctccaggttcgggccatcctgcagcagctgggcctgaacagcacctgcgacgacagt
atcctcgtcaagaccgtgtgcggggtggtgtccaggagggccgcgcagctgtgtggtgct
ggcatggctgccgtggtggataagatccgggaaaacagagggctggaccatctcgatgtg
accgtgggggtggatggaactctctacaagcttcatccgcacttctccagaatcatgcac
caaaccgtgaaggaactgtcaccaaagtgtaacgtgtccttcctcctgtccgaagatggc
agtggcaagggggctgccctcatcacggcagtgggcgtccggctccggaacgaagcgggc
agctaa

DBGET integrated database retrieval system