KEGG   Myotis davidii: 102763999Help
Entry
102763999         CDS       T02992                                 

Gene name
PAX8
Definition
(RefSeq) paired box 8
  KO
K09293  paired box protein 8
Organism
myd  Myotis davidii
Pathway
myd04918  Thyroid hormone synthesis
myd05200  Pathways in cancer
myd05202  Transcriptional misregulation in cancer
myd05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102763999 (PAX8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102763999 (PAX8)
   05202 Transcriptional misregulation in cancer
    102763999 (PAX8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    102763999 (PAX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myd03000]
    102763999 (PAX8)
Transcription factors [BR:myd03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    102763999 (PAX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_23 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 102763999
NCBI-ProteinID: XP_006771398
LinkDB All DBs
Position
Un
AA seq 458 aa AA seqDB search
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGSRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDN
DTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGST
YSINGLLGIAQPGSDSKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLEC
PFERQHYPEAYTSPGHTKGEQGLYPLPLLNSALDDGKATLTPSNTPLGRNLSTHQTYPVV
TDPHSPFAIKQESPEVSSSSSTPSSLSSSAFLDLQQAGSGVPAGASVPPFNAFPHAASVY
GQLAGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYSHTPYSS
YSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacaactccatcagatccggccacggagggctgaaccagctgggcggggccttc
gtgaacggcagacccctgcccgaagtggtgcgtcagcgcatcgtggacctggcccaccag
ggcgtgaggccctgtgacatctcccgccagcttcgcgtcagccatggctgtgtcagcaag
attcttggcagtaggtactacgagactggcagcatccggcctggggtgataggtggctcc
aagcccaaggtggctacccccaaggtggtagagaagatcggggactacaagcgacagaac
cccaccatgtttgcctgggagatccgagatcggctcctggctgagggcgtctgtgacaac
gacactgtgcccagtgtcagctccatcaacagaatcatccggaccaaagtgcagcaacca
ttcaatctccccatggacagctgcgtggccaccaagtccctgagccccggacacacactg
atccccagctcggccgtgacacccccggagtcaccccagtccgactctctgggctccacc
tactccatcaatgggctgctggggatcgcccagcccggcagcgacagcaagaggaagatg
gatgacagtgaccaggacagctgccggctgagcatcgactcccagagcagcagcagtgga
ccccgcaagcatctccgcacggacgccttcagccagcaccacctcgagccccttgagtgc
cccttcgagcggcagcactacccggaggcctacacctccccgggccacaccaaaggcgag
cagggcctctacccgctgcccctgctcaacagcgccctggacgacgggaaggccaccctg
accccttccaacacacccttggggcgcaacctctcgactcaccagacctaccccgtggtg
acagatcctcactcacccttcgccataaagcaggaaagccccgaggtgtccagttctagc
tccaccccttcctctttatctagctccgcctttttggacctgcagcaagccggctctggg
gtccccgcgggagcctcggtcccgcccttcaatgcctttccccacgctgcctcagtgtac
gggcagctcgcgggccaggccctcctctcagggcgagagatggtgggtcccacgctgccc
ggatacccaccccacatccccaccagtggacagggcagctatgcctcctctgccattgca
ggcatggtggcaggaagtgaatactctggcaatgcctacagccacaccccctactcctcc
tacagcgaggcctggcgcttccccaactccagcttgctgagttccccatattattacagt
tccacatcgaggccgagcgcgccgcccaccaccgccacggcctttgaccacctgtag

DBGET integrated database retrieval system