KEGG   Myotis davidii: 102766070Help
Entry
102766070         CDS       T02992                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
myd  Myotis davidii
Pathway
myd00020  Citrate cycle (TCA cycle)
myd00190  Oxidative phosphorylation
myd01100  Metabolic pathways
myd01200  Carbon metabolism
myd04714  Thermogenesis
myd04932  Non-alcoholic fatty liver disease (NAFLD)
myd05010  Alzheimer disease
myd05012  Parkinson disease
myd05016  Huntington disease
Module
myd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
myd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
myd_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102766070 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102766070 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102766070 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102766070 (SDHA)
   05012 Parkinson disease
    102766070 (SDHA)
   05016 Huntington disease
    102766070 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102766070 (SDHA)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102766070 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 102766070
NCBI-ProteinID: XP_006762508
LinkDB All DBs
Position
Un
AA seq 662 aa AA seqDB search
MSGLRVASRLLRPRRLALTGTRPLSSGSRGFDFTVDGSKRSSAKVSDSISTQYPVVDHEF
DAVVVGAGGAGLRAAFGLSEAGFSTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWH
FYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTKDGKIYQRAFGGQSLKFGK
GGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDG
YIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYG
AGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKD
HVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNFKGQVL
RHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVP
PIKANAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCEKISQL
YGELKHLKTFDRGMVWNTDLLETLELQNLMLCALQTIYGAEARKESRGAHAREDYKDRVD
EYDYSKPIQGQQKKPFEQHWRKHTLSYVDVGTGKVSLKYRPVIDKTLNESDCATVPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggctccgagttgcgtcgaggctgctgcgccccagacgcctggcgctgactggg
acgcggccattatcatcgggatcccgtggttttgacttcactgttgatgggagtaagagg
tcatctgctaaagtttcagattcaatttctacacaatacccagtagtggatcatgaattt
gacgctgtggtggttggcgctggaggggcaggcttgcgagctgcgtttggcctttctgag
gcagggtttagcaccgcatgtgttacaaagctctttcccaccaggtcccacactgtggca
gcccagggaggaatcaatgctgctctggggaacatggaggaggacaactggaggtggcac
ttctatgacaccgtgaagggctctgactggctgggagaccaggatgccatccactacatg
acagagcaggcccccgcctctgtgattgagctagagaattatggcatgccatttagcaga
accaaggatgggaagatctaccagcgggcctttgggggacagagcctcaagtttgggaaa
ggtggacaagcccatcgttgctgctgcgttgctgaccgcaccggccattcactgctgcac
acgttgtatggaaggtctttgcgatatgataccagctattttgtggagtattttgccttg
gatcttctgatggaaaatggggaatgtcgtggtgttattgcactgtgcatagaagacggg
tacatccaccgcatcagagcaaagaacacagttatagctactggaggctatgggcgcacc
tactttagctgcacgtctgcccacactagcaccggagatggcactgcaatggtcaccagg
gcaggccttccctgccaggacttggagtttgttcagttccaccccacaggcatatatggt
gctggctgtctcatcacagaagggtgccgtggagagggaggcattctcattaacagtcaa
ggcgagaggttcatggagcgctatgccccggtggccaaggacctggcctccagagacgtc
gtgtcccggtccatgactctggaaatccgtgaaggaagaggctgtggccctgagaaagat
cacgtctacctgcagttgcaccacctgcccccggagcagctcgccatgcgcctgcctggc
atttcagagacggccatgatctttgcgggtgtggacgtcaccaaggagccgatccctgtc
cttcccaccgtgcactataacatgggtggcattcccaccaacttcaagggacaggttctg
aggcatgtgaacggccaggaccaggttgtgcctggcctgtacgcttgtggagaggccgcc
tgcgcctcggtgcatggtgccaaccgtcttggggcaaactcactcttggacctggtcgtc
tttggccgggcatgtgccttgagtatcgcagagtcctgcagacccggagataaagttccc
cctattaaagcaaatgctggggaagaatctgtcatgaatcttgacaagttgagatttgct
gatggaagcataagaacatcggagctacgactcaacatgcagaagtcgatgcagaatcat
gccgcagtgttccgtgtgggcagtgtgttacaggagggctgtgagaaaatcagccagctc
tacggggagctaaaacatctgaagacgtttgacagaggaatggtctggaacacagacctg
ctggagaccttggagctgcagaacctgatgctctgtgcgcttcagaccatttatggagca
gaggcccggaaggagtcacgcggtgcccatgctcgggaagattacaaggaccgggttgat
gaatatgattattccaagcccatccaggggcagcagaagaagccatttgagcagcactgg
aggaagcacaccctttcctatgttgatgttgggactgggaaggtttctctgaaatacaga
cctgtaatcgacaaaactttaaatgagtctgactgcgccacagtccccccagccattcgc
tcctactga

DBGET integrated database retrieval system