KEGG   Myotis davidii: 102766495
Entry
102766495         CDS       T02992                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
myd  Myotis davidii
Pathway
myd04010  MAPK signaling pathway
myd04014  Ras signaling pathway
myd04015  Rap1 signaling pathway
myd04151  PI3K-Akt signaling pathway
myd04390  Hippo signaling pathway
myd04810  Regulation of actin cytoskeleton
myd05200  Pathways in cancer
myd05218  Melanoma
myd05224  Breast cancer
myd05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102766495 (FGF1)
   04014 Ras signaling pathway
    102766495 (FGF1)
   04015 Rap1 signaling pathway
    102766495 (FGF1)
   04390 Hippo signaling pathway
    102766495 (FGF1)
   04151 PI3K-Akt signaling pathway
    102766495 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102766495 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102766495 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102766495 (FGF1)
   05218 Melanoma
    102766495 (FGF1)
   05224 Breast cancer
    102766495 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:myd04052]
    102766495 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:myd00536]
    102766495 (FGF1)
Cytokines and growth factors [BR:myd04052]
 Growth factors
  Growth factors (RTK binding)
   102766495 (FGF1)
Glycosaminoglycan binding proteins [BR:myd00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102766495 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102766495
NCBI-ProteinID: XP_006777052
LinkDB
Position
Un
AA seq 155 aa
MAEGEVTTFTALTERFNLPLENYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTESGQYLAMDSDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgagggggaagtcaccacgttcacggccctgaccgagaggttcaatctgcctctg
gagaactacaagaagcccaagcttctctactgcagcaacgggggccacttcctgcggatc
ctcccagacggcacagtggatgggacgagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagcaccgagagtggccagtacttg
gccatggactccgacgggcttttgtacggctcacaaacacccaatgaggaatgtttgttc
ctggaaaggctggaggagaaccactacaacacctacacgtccaagaagcacgcagaaaag
aattggttcgttgggctcaagaagaacggaagctgcaagcgtggtcctcggacacattat
ggccagaaagcaatcttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system