KEGG   Myotis davidii: 102766538Help
Entry
102766538         CDS       T02992                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
myd  Myotis davidii
Pathway
myd04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:myd00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    102766538 (F13A1)
Enzymes [BR:myd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102766538 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102766538
NCBI-ProteinID: XP_006766157
LinkDB All DBs
Position
Un
AA seq 732 aa AA seqDB search
MTETPRPAFGGRRAVPLNNSNAEENNPPTEELLGLVPRGVNLQDYLHVTTVHLFKEPWDT
NKVDHHTDKYNNNKLIVRRGQPFYIQIEFNRPYNPRKDLFRVEYVIGRYPQENKGTYIPV
PVVPELQSGKWGAKVISREDRSVRLSIQSSPECIVGKFRMYVAVWTPYGILRTSRNPETD
TYILFNPWCEEDAVYLDDDREREEYVLNDIGVIFYGDFNNIKSRSWSYGQFEDGILDACL
HMMDKAQMDLSGRGNPIKVSRVGSAMVNSKDDEGVLVGSWDNVYAYGVPPSAWTGSIDIL
LEYQSSQNPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQMDIFLQEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVEAVDTTHVGKLIVTKQIGGDGMKDITD
NYKFQEGQKEERLALETALMYGVKKPLNTEGIVKQRPNVDMDFEVENAVLGKDFKVTITF
QNNTPKAYTISAYLTGNITFYTGVSKEEFKNETFEVALDPLSFKKEEVLVRASEYMGQLL
EQASLHFFVTARVDETGDILAKQKSTVLTIPSIIIKVRGAQMVGSDMVVTVEFTNPLKES
LKNVWIRLEGPGVIKPMRKMFREIRPNSTVQWEEVCRPWVPGLRKLMASMTSDSLRHVYG
ELDLQIQRQRTV
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgacggagacccccaggcccgcctttggaggcaggagagctgtccccctcaacaactcc
aatgctgaagagaacaaccctcccactgaggagctgctgggcctggtgccccgaggtgtc
aacctgcaagactaccttcatgttacgactgttcacctgttcaaagagccatgggacacc
aacaaagtggatcaccacactgacaagtataacaacaacaagctaattgtgcgtagagga
caacctttctacatccagatcgaattcaatcgtccatacaaccccagaaaagatctcttc
agggtggaatatgtcattgggcgctaccctcaggagaacaagggaacctacatcccagtt
cctgtcgttcctgagctgcagagtggcaaatggggggccaaagtcatcagcagagaggac
aggtctgtccgtctgtccatccagtcttccccggagtgcattgtggggaaattccgcatg
tacgttgccgtctggaccccctatggtatactccgcaccagccggaacccagaaaccgac
acctacattctcttcaatccttggtgtgaagaggatgctgtgtacctggatgatgacaga
gagagagaagaatatgtcctgaatgacatcggggttattttttacggagacttcaataac
atcaagagtagaagctggagctatggtcagtttgaggatggcatcctggacgcttgcctg
cacatgatggacaaagcacagatggacctttccggccgagggaatcccatcaaagtcagc
cgcgttggatctgcaatggttaattccaaagatgatgaaggtgtgctggttggatcctgg
gacaatgtctatgcctatggcgtgcccccatcagcctggactggaagcattgacattctg
ttggaatatcagagttctcagaatccagttcggtatggtcagtgctgggtttttgctggt
gtctttaacacatttttgcgatgccttgggataccagcaagagttgttaccaattatttc
tcagctcatgataatgatgccaatttgcaaatggacatcttcctgcaagaagatgggaat
gtgaactccaaactcaccaaggattcagtgtggaactaccactgctggaatgaagcctgg
atgacgaggcctgatcttcccgttggatttggaggctggcaggcggtggacagcaccccc
caggaaaacagtgacgggatgtaccggtgtggccccgcctctgttcaagccattaagcat
ggccacgtttgcttccagtttgatgcacccttcgtttttgcagaggtcaacagtgatctt
gtttacattacagctaaaaaagatggcactcatgtggtggaagctgttgataccacccac
gttgggaaattaattgtgaccaaacaaattggaggagatggcatgaaggatattactgat
aactacaaattccaagaaggtcaaaaagaagagagactggccctggaaacggccctgatg
tacggggttaaaaagcccctcaacacggaaggcatcgtgaaacaaaggcctaacgtggac
atggactttgaagtggaaaatgctgtgctgggaaaggacttcaaggtcaccatcaccttc
cagaacaacaccccgaaagcttacaccatctcagcctatctcacgggcaacatcaccttc
tacaccggcgtctccaaggaggaattcaagaacgagacatttgaagtggctctggatccc
ttgtccttcaagaaagaggaggtgctggtcagagccagcgagtacatgggccagctgctg
gagcaagcgtctctgcacttctttgtcacagcccgtgtcgatgagaccggggatattctg
gccaagcagaagtccactgtgctgaccatcccctcgatcatcatcaaggtccgtggtgct
cagatggttggttctgacatggttgtgacagttgagttcaccaatcccttaaaggaatca
ctgaaaaatgtttggatacgcctggaaggtcctggagtgataaaaccaatgaggaagatg
ttccgtgaaatccggcccaactccactgtgcaatgggaagaagtgtgtcggccttgggtc
cccggcctccggaagctgatggccagtatgaccagcgactccctgagacatgtgtatggc
gagctggatttgcagattcaaagacaacgtactgtgtaa

DBGET integrated database retrieval system