KEGG   Myotis davidii: 102767216Help
Entry
102767216         CDS       T02992                                 

Gene name
H6PD
Definition
(RefSeq) hexose-6-phosphate dehydrogenase/glucose 1-dehydrogenase
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
myd  Myotis davidii
Pathway
myd00030  Pentose phosphate pathway
myd01100  Metabolic pathways
myd01200  Carbon metabolism
Module
myd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
myd_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102767216 (H6PD)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     102767216 (H6PD)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     102767216 (H6PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C Glucosamine_iso G6PD_N
Motif
Other DBs
NCBI-GeneID: 102767216
NCBI-ProteinID: XP_006766872
LinkDB All DBs
Position
Un
AA seq 766 aa AA seqDB search
MLAELCCKRRPGLWRMLAVAVFVALLGCLRAQELRGHVSIVLLGATGDLAKKYLWQGLFQ
LYLEEAGKGHNFSFHGTALTATEQGQEVVAKVLESLSCPKDVAPARCAELKDQFQRLSQY
RQLKTTEDYAALSKDIEALVQREGLWEAGRIFYFSVPPFAYTDIARSINSSCRPGPGAWL
RVVLEKPFGHNHLSAQQLATDLGSFFHEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGL
WNRHQVERVEIVMKETVDAEGRTSFYEEYGVIRDVLQNHLTEILTLVAMELPPDISSSED
VLRHKLQVFQALRGLRRGSAVLGQYQAYSEQVRRELDKPAGFLSLTPTFAGILVHLDNLR
WEGVPFLLMSGKALDERMGYVRVLFKNRACCAQSEQHWVAEQSACLPRQIIFYIGHGALG
SPAVLVSRNLFRPTLPGSWEEVGGPPGLHLFGRPLSDFYAYSPVREQDAYSVLISRIFHG
RKDSFITTENLLASWAFWTPLLDSLAHEAPRLYPGGAENGHLLDFEFSGGQLSFSVQQPE
QLVPGPGSAPAPSDFQVLRSTYRDRPLVTAWPEELIAKLADDIEAAAMKAVRRSGQFHLA
LSGGSSPVALFQQLAMGHYAFPWAHTHLWLVDERCVPLWDPESNFQGLQTHLLQHVRLPH
YHVHPMPVHLRQRLCAQEDQGAQAYAEEISALVANSTSGPRRRMSLSLPLINRARRVAVL
VMGRLKREITLLVSRVGHEPKKWPISGVQPVSGQLVWYMDYEAFLG
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgttagcagagctgtgctgtaaaaggcgtccgggcttgtggaggatgctggcggtggcc
gtgttcgtggccctcctgggctgcctgcgggcccaggagctgcggggacacgtctccata
gtcctgctgggagccactggggacctggccaagaagtacctgtggcaggggctgttccag
ctgtacctggaggaggcggggaagggccacaatttcagcttccatgggactgctctgacg
gccaccgagcagggccaggaggtcgtggccaaggtcctggagtccctttcctgtcccaag
gatgtggcacccgctcgctgtgctgaactcaaggaccagttccagcggctgagccagtac
cgccagctgaagaccacggaggactacgcggctctgagcaaggacatcgaggcgctggtg
cagcgcgagggcctctgggaggcgggccgcattttctacttctccgtgccgcccttcgcc
tacacggacatcgcccgcagcatcaacagcagctgccgcccgggccccggcgcctggctg
cgcgtcgtcctggagaagcccttcggccacaaccacctgtcagcgcagcagctggccacg
gacctcgggagctttttccacgaggaggagatgtaccgggtggaccactacctgggcaag
caggccgtggctcagatcctgcctttccgagaccagaaccgcaaggccctggacggcctg
tggaaccggcaccaggtggagcgggtggagatcgtcatgaaggagacggtggatgcagaa
ggtcgcaccagcttctacgaggagtacggggtcatccgcgacgtcctgcagaaccacctg
acggagatcctcacgctggtggccatggagctgccccccgacatcagcagctcggaggac
gtgctgcggcacaaactgcaggtcttccaggcgctgcggggcctccggaggggcagcgcc
gtcctgggccagtaccaggcctacagcgagcaggtgcgcagggagctggacaagccggcc
ggcttcctcagcctgacgccgaccttcgcaggcatcctcgttcacctggacaaccttcgc
tgggagggcgtcccttttctcctgatgtcgggcaaagccttggacgagagaatgggctac
gtccgggtcttgttcaagaaccgggcgtgttgtgcgcagagcgagcagcactgggtcgcg
gagcagagtgcgtgtctgccgcgccagatcatcttctacatcgggcacggcgcgctgggc
agccccgcggtgctggtgagccggaacctgttcaggcccacgctgcccggcagctgggag
gaggtggggggcccgcccgggctccaccttttcggccgcccactgtctgatttctatgcc
tacagtcctgtgcgggagcaggacgcctactccgtcctcatatcccgcatcttccacggc
cgcaaggactccttcatcaccacggagaacttgctggcctcctgggccttctggacgccc
ctgctggacagcctggcccacgaggccccccgcctctaccccggaggggcggagaacggg
cacctgctggactttgagttcagtggcggccagttgtccttctcggtgcagcagccggag
cagctggtgccggggcccggctctgctcccgcgcccagcgacttccaggttctcaggtcc
acgtaccgagatcgcccgctggtcacggcctggcctgaggagctgatcgcaaagctggcc
gacgacatcgaggcggccgccatgaaggccgtgcggcgctctggccagttccacctggcg
ctctcgggcggctccagccccgtggccctgttccagcagctggccatgggccactacgcc
ttcccctgggcccacacgcacctgtggctggtggacgagcgctgcgtgccgctctgggac
cccgagtccaacttccagggcctgcagacgcacctgctgcagcatgttaggctcccgcac
taccacgtgcaccccatgcccgtgcacctgcgccagcggctctgcgcccaggaggaccag
ggcgcccaggcctacgccgaggagatctccgccctggtcgccaacagcacctcggggccg
cgccgccgcatgagcctcagcctgcccctcatcaaccgcgccaggagggtggcggtcctg
gtcatgggccggctgaagcgcgagatcaccctgctggtgagccgcgtcggccacgagccc
aagaagtggcccatctcgggcgtccagcccgtgtcgggccagctggtgtggtacatggac
tacgaggcgtttctggggtga

DBGET integrated database retrieval system