KEGG   Myotis davidii: 102767346
Entry
102767346         CDS       T02992                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
myd  Myotis davidii
Pathway
myd04022  cGMP-PKG signaling pathway
myd04141  Protein processing in endoplasmic reticulum
myd04151  PI3K-Akt signaling pathway
myd04211  Longevity regulating pathway
myd04261  Adrenergic signaling in cardiomyocytes
myd04668  TNF signaling pathway
myd04728  Dopaminergic synapse
myd04911  Insulin secretion
myd04915  Estrogen signaling pathway
myd04918  Thyroid hormone synthesis
myd04925  Aldosterone synthesis and secretion
myd04926  Relaxin signaling pathway
myd04927  Cortisol synthesis and secretion
myd04928  Parathyroid hormone synthesis, secretion and action
myd04934  Cushing syndrome
myd04935  Growth hormone synthesis, secretion and action
myd05020  Prion disease
myd05030  Cocaine addiction
myd05031  Amphetamine addiction
myd05034  Alcoholism
myd05161  Hepatitis B
myd05163  Human cytomegalovirus infection
myd05166  Human T-cell leukemia virus 1 infection
myd05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102767346 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102767346 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102767346 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102767346 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102767346 (ATF6B)
   04915 Estrogen signaling pathway
    102767346 (ATF6B)
   04926 Relaxin signaling pathway
    102767346 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102767346 (ATF6B)
   04918 Thyroid hormone synthesis
    102767346 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102767346 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102767346 (ATF6B)
   04927 Cortisol synthesis and secretion
    102767346 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102767346 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102767346 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102767346 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102767346 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102767346 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102767346 (ATF6B)
   05031 Amphetamine addiction
    102767346 (ATF6B)
   05034 Alcoholism
    102767346 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102767346 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102767346 (ATF6B)
   05161 Hepatitis B
    102767346 (ATF6B)
   05163 Human cytomegalovirus infection
    102767346 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myd03000]
    102767346 (ATF6B)
Transcription factors [BR:myd03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102767346 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB DUF4407 GIT_CC bZIP_Maf YabA Docking
Other DBs
NCBI-GeneID: 102767346
NCBI-ProteinID: XP_006772906
LinkDB
Position
Un
AA seq 696 aa
MAELMLLSEIADPTRFFTDNLLGPEDWGARRPRSPGSAPAVSHNPPMPPLQFGSGMLDVG
MDVSPPEPPWDPLPLFPDLQVKSEPSSPCSSSSLSSESSGLSTEPSPRAPGVGEVLVVKI
ESLAPPLCLLGDDPTSPSETVQINVGPTADDPSGVQTKTEPVSPSSINSEASLLSTESPS
QAFVGKEALEVKAESPAPQGCLLREVPGPPLGAVQISMGPPPEGSSGKALPARKPPLQPK
PVVITTVPVPPSAVPPSTTVLLQPLAQPPPVSPVVLIQGAIRVQPEGPAPPAPRPERKSI
VPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLADNQQL
RRENAALRRRLEALWTENSELKLGSGNRKVVCIVVFLLFIAFNFGPVSISEPPPAPVSPR
MSMSGEEPRPRRHLLEFSAQLPVLGVQSLQDPSQGPQEPQPSLEGRPSFRNLTALPGAXE
LLLPGLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKVPRRAQERQKSQRRKKL
PPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHLLLPA
ISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTSTVPPSL
RKQPSTPGNATGGPFSASAAGQAHQATHRPLYLNHP
NT seq 2091 nt   +upstreamnt  +downstreamnt
atggcggagctaatgctcctcagcgagattgcggacccgacgcggtttttcaccgacaac
ctgctgggcccggaggactggggtgcgcggcggccccggagcccgggctcggccccagcc
gtttctcacaacccccccatgcccccccttcagttcggcagcggcatgctggacgtgggg
atggatgtcagcccccccgagcctccgtgggaccccctgcctctctttccagatcttcag
gtgaagtctgagccgtcctctccctgctcctcctcctctctcagctccgagtcgtcgggc
ctttccacggagccctccccccgggcccccggtgtaggggaggtgctggttgtgaagata
gagtccttggcaccaccgctctgcctgctgggagatgatccaacatccccgagtgaaacg
gtccagatcaatgtgggccccaccgctgatgacccctcaggggtccagacgaagacagaa
cccgtctctccttcctccatcaactctgaggcttccttgctctccacagagtcccccagc
caggcttttgtagggaaggaggcactggaagtgaaggccgagtccccagcccctcagggg
tgtctccttcgggaggtccctggcccgccacttggagctgtccagatcagcatgggcccg
ccccccgagggctcctcaggcaaagccctgcctgcccggaagccaccactgcagccgaaa
cctgtggtgataaccacggtcccagtgccgcccagcgcggtgccccccagcaccaccgtc
cttctgcagcccctggcccagccacccccagtgtccccagttgtccttatccaaggtgct
attcgagtccagcctgaggggccagccccccctgcgcctcggcctgagaggaagagcatc
gttccagctcctatgcctgggaactcctgcccccctgaagtggacgcaaagctgctgaag
cggcagcagcgaatgatcaagaaccgggagtcggcctgccagtcccggaggaagaagaag
gagtacctgcaggggctggaggcgcggctgcaggccgtgctggccgacaaccagcagctg
cgcagggagaacgctgccctccggcggcggctggaggccctgtggaccgagaacagcgaa
ctcaagttagggtctgggaacaggaaggtggtctgcatcgtggtcttccttctcttcatt
gccttcaactttgggcctgtcagcatcagtgagcctcctccggctcccgtctctcctcgg
atgagcatgagcggagaggagcctcggccccggagacacctgctggagttctcagcgcag
ctgcccgtccttggagtccagtccctccaggacccctcccagggcccccaggagccccag
cccagccttgagggccggccgagtttcaggaacctgacggcgctccccggggcgncggag
ctgctgctgccaggcctggaccagctcttcctctcctcggattgccgccacttcaaccga
accgagtccctcaggcttgctgacgagctgagcggctgggtgcagcgccaccagcgaggc
cggcggaaggtgccccgcagggcccaggagagacagaagtctcagcgacggaagaagttg
cctccagttaaggcagtccccactcagcctcccgggcccccagaaagggattctgtgggc
cagctgcagctatatcgccacccggaccgttcacagccagagttcctggatgcaattgac
cgacgggaagacacattttatgttgtctccttccggcgggaccacctgctgctcccagcc
atcagccacaataagacctctcggcccaagatgtccctggtgatgcccgccatggccccc
aatgagaccctgtcagggcggggtgcccctggggactatgaggagatgatgcagatcgag
tgtgaggtcatggacaccagggtgattcacatcaagacctccacggtgcccccctcgctc
cgaaaacagccttccaccccgggcaatgccacaggtggccccttctcagcttctgcagcc
ggccaggcccaccaggccacccatcggcccctctacctcaatcacccctga

DBGET integrated database retrieval system