KEGG   Myotis davidii: 102768087
Entry
102768087         CDS       T02992                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
myd  Myotis davidii
Pathway
myd00220  Arginine biosynthesis
myd00330  Arginine and proline metabolism
myd01100  Metabolic pathways
myd04020  Calcium signaling pathway
myd04066  HIF-1 signaling pathway
myd04146  Peroxisome
myd04371  Apelin signaling pathway
myd04926  Relaxin signaling pathway
myd05010  Alzheimer disease
myd05014  Amyotrophic lateral sclerosis
myd05022  Pathways of neurodegeneration - multiple diseases
myd05133  Pertussis
myd05140  Leishmaniasis
myd05142  Chagas disease
myd05145  Toxoplasmosis
myd05146  Amoebiasis
myd05152  Tuberculosis
myd05200  Pathways in cancer
myd05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102768087 (NOS2)
   00330 Arginine and proline metabolism
    102768087 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102768087 (NOS2)
   04066 HIF-1 signaling pathway
    102768087 (NOS2)
   04020 Calcium signaling pathway
    102768087 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102768087 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102768087 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102768087 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102768087 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102768087 (NOS2)
   05014 Amyotrophic lateral sclerosis
    102768087 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    102768087 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102768087 (NOS2)
   05152 Tuberculosis
    102768087 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102768087 (NOS2)
   05145 Toxoplasmosis
    102768087 (NOS2)
   05140 Leishmaniasis
    102768087 (NOS2)
   05142 Chagas disease
    102768087 (NOS2)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102768087 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102768087
NCBI-ProteinID: XP_006770963
LinkDB
Position
Un
AA seq 972 aa
MTLQDTLHHKAKADLACKSKCCLGSIMNSKSLTRGPRDKPTSPDELLPQAIEFVNQYYSS
FKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIYATKQAWRNAPRCIGRIQWSNLQVFD
ARRCSTAQEMFEHICRHLRYSTNNGNIRSAITVFPQRSDGKHDFRVWNSQLIRYAGYQMP
DGTIRGDPACVEFTQLCIDLGWKPKYGRFDVVPLVLQAGGRDPELFEIPPDLVLEVPMEH
PKYEWFQELGLKWYALPAVSNMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILE
EVGRRMGLETHKLASLWKDQAVVEINVAVLHSFQKLNVTIMDHHSAAESFMKYMQNEYRS
RGGCPADWIWLVPPISGSITPVFHQEMLNYVLSPFYYYQVEAWKTHVWQDGKLRPRRREI
RFQVLVKAVLFASILMRKTMASRVRATILFATETGKSETLAQDLGALFSCAFNPKVLCMD
EYRLSSLEEEQLLLVVTSTFGNGDSPGNGAKLKKSLFMLKELTNKFRYAVFGLGSSMYPQ
FCAFAHDVDQKLSHLGASQLIPTGEGDELSGQEEDFRSWAVQTFKAACEAFDVRGKHRIQ
IPKLYTTNVTWDPHHYRLVRDSQPLDLNKALSGMHAKNVFTMKLKSRQNLQSPKSSRTTL
LVELSCEGSPGLSYQPGEHLGVFPSNQPALVQGILERVVDGPAPHQPVCLETLSETGSYW
ARDKQLPPCSLSQALTYFLDITTPPTQLLLRKLAQLATEEPERQRLETLCQPSEYNTWKF
TNSPTFLEVLEEFPSLRVSASFLLSQLPVLKPRYYSISSSRDRTPTEVHLTVAVLTYRTR
DGQGPLHHGVCSTWLSSLKPQDPVPCFVRSASGFQLPEDPSRPCILIGPGTGIAPFRSFW
QQRLHDTEHKGLQRGHMTLVFGCRRPDEDHLYREEMLEMARKGVLHEVHTAYSRLPGQPK
VMGQLPVQWEEH
NT seq 2919 nt   +upstreamnt  +downstreamnt
atgactctccaagacacacttcaccacaaggccaaagcggatttggcttgcaagtccaag
tgttgcttgggatccatcatgaactccaaaagcttgaccagaggacccagggacaagcct
acctccccagacgagcttctacctcaagctatcgaatttgtcaatcagtattacagctcc
ttcaaagaggcaaaaatagaggaacatctggccagggtggaagctgtaacaaaggagata
gaaacaacaggaacctaccagctgacgggagatgagctcatctacgccaccaagcaggcc
tggcgcaatgccccacgctgcatcggaaggatccagtggtccaacctgcaggtcttcgac
gcccggcgctgttccactgcccaggaaatgttcgagcacatctgcagacacctgcgttac
tccaccaacaacggcaacatcaggtcggccatcacggtgttcccgcagcggagcgatggg
aagcatgacttccgagtctggaactcccagctcatccgctatgccggctaccagatgccg
gatggcaccatccgcggggaccccgcctgcgtggagttcacccagctgtgcatcgacctg
ggctggaaacccaagtatggccgcttcgacgtggtgcctctggtcctgcaggccggcggc
cgcgaccctgagctcttcgagatcccgcccgaccttgtgctcgaggtgcctatggaacat
cccaagtacgagtggttccaggagctggggctgaagtggtacgccctgcctgccgtgtcc
aacatgctgctcgaggtgggtggcctggagttcccagggtgccccttcaacggctggtac
atgggcacagagatcggagtccgggacttctgtgacgtccagcgctacaacatcctggag
gaggtgggcagaaggatgggcctggaaacgcacaagctcgcctcactctggaaggaccag
gctgtcgttgagatcaatgtcgccgtgctccacagtttccagaagctaaatgtgaccatc
atggaccaccactcggctgcagagtccttcatgaagtacatgcagaacgagtaccggtcc
cgagggggctgccccgccgactggatttggctggtgccccccatttctggcagcatcacc
cccgtgttccaccaggagatgttaaactatgttctgtcccctttctactactaccaggtg
gaagcgtggaaaacccacgtctggcaggacgggaagctgaggccccggagaagagagatt
cggtttcaagtcctggttaaagccgtgctcttcgcctctatactgatgcgcaagaccatg
gcgtcccgagtcagagccaccatcctctttgcgacggagacgggaaaatcggaaacgctg
gcccaggacctaggggctttgttcagctgtgccttcaaccccaaggttctctgcatggac
gagtacaggctgagcagcctggaggaggagcagctgctgctggtggtgaccagcaccttt
gggaacggagactcccccggcaatggagcgaaactgaagaaatccctcttcatgctgaaa
gagctcaccaacaagttcaggtatgccgtgtttggactcggttccagcatgtaccctcag
ttctgcgcctttgctcatgatgtcgaccagaagttgtcccacctgggagcgtctcagctc
atcccgacgggggaaggggacgagctcagtgggcaggaagaggacttccgcagctgggcc
gtgcaaaccttcaaggcagcctgtgaggcgttcgatgtccgaggcaaacaccgcattcaa
atccccaagctctacaccaccaatgtgacctgggacccgcaccactaccggctcgtgcgg
gactctcagcctttggacctcaacaaagccctcagcggaatgcacgccaagaatgtgttc
accatgaagctcaagtcgcggcagaatctacagagccccaaatccagccgcaccacgctc
ctggtggaactctcctgtgagggcagcccaggcctcagctaccagcctggagagcacctg
ggggttttcccaagcaaccagccagctctggttcaaggcattttggagcgagtggtggac
ggccccgcaccccaccaacccgtgtgcctggagaccctcagcgagactggcagctactgg
gcccgggacaagcagctgcccccctgctccctcagccaggccctcacctacttcctggac
atcaccacgcccccaacccagctgctgctccgaaagctggctcagctggccacagaagaa
ccggagaggcagaggctagagaccctgtgccagccctcagaatacaatacgtggaagttc
accaacagtcccacattcctggaggtgctggaggagttcccgtccctgcgggtatctgcc
agcttcctgctctcccagctccctgtcctgaaaccccggtactactccatcagctcctcc
agggaccgcacccccacggaggtccacctcaccgtggccgtgctcacctaccgcacccga
gatggccagggtcccctgcaccatggtgtctgcagcacatggctcagcagcctgaaaccc
caagacccagtgccctgttttgtaagaagtgccagcggcttccagctccccgaggacccc
tcccgtccttgcatcctcattggacccggcacgggcattgcccccttccgcagtttctgg
cagcagcgactccatgacactgagcacaaagggctccagagaggccacatgaccctggtg
tttgggtgccggcgcccagatgaggaccacctttaccgggaggagatgttggagatggcc
cggaagggggtgctgcatgaggtgcacacagcctattctcgcctgcctggccagcccaag
gtaatggggcaactgcccgtgcagtgggaggagcattaa

DBGET integrated database retrieval system