KEGG   Myotis davidii: 102768972
Entry
102768972         CDS       T02992                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
myd  Myotis davidii
Pathway
myd01521  EGFR tyrosine kinase inhibitor resistance
myd04010  MAPK signaling pathway
myd04012  ErbB signaling pathway
myd04014  Ras signaling pathway
myd04151  PI3K-Akt signaling pathway
myd04915  Estrogen signaling pathway
myd05200  Pathways in cancer
myd05210  Colorectal cancer
myd05211  Renal cell carcinoma
myd05212  Pancreatic cancer
myd05214  Glioma
myd05215  Prostate cancer
myd05223  Non-small cell lung cancer
myd05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102768972 (TGFA)
   04012 ErbB signaling pathway
    102768972 (TGFA)
   04014 Ras signaling pathway
    102768972 (TGFA)
   04151 PI3K-Akt signaling pathway
    102768972 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102768972 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102768972 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102768972 (TGFA)
   05212 Pancreatic cancer
    102768972 (TGFA)
   05225 Hepatocellular carcinoma
    102768972 (TGFA)
   05214 Glioma
    102768972 (TGFA)
   05211 Renal cell carcinoma
    102768972 (TGFA)
   05215 Prostate cancer
    102768972 (TGFA)
   05223 Non-small cell lung cancer
    102768972 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102768972 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 102768972
NCBI-ProteinID: XP_006775369
LinkDB
Position
Un
AA seq 156 aa
AGQLALLALGLVLAVCQALENTTSALSANPPMAAAVVSYFHDCPDSHSQFCFHGTCRFLV
QEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSVVALAGLIITCVLIHCC
QVRKYCEWCRALICRHEKPSALLKGRPACCHSETVV
NT seq 471 nt   +upstreamnt  +downstreamnt
gctggacagctcgccctgctcgcgctgggtcttgtgttggctgtgtgtcaggcgctggag
aacactacatctgccttgagtgcaaatccacctatggccgcagctgtcgtgtcctacttt
catgattgcccggattcccacagtcagttctgcttccatggaacctgcaggtttttggtg
caggaggacaagccagcatgtgtctgccactctgggtatgtcggagcgcgctgtgagcat
gcagacctcctggccgtggtggccgccagccagaagaagcaggccatcaccgccttagtg
gtggtttccgtcgtggccctggctggcctcatcatcacgtgtgtgctgatacactgctgc
caggtccgaaaatactgtgagtggtgccgggccctcatctgccggcacgagaagcccagc
gccctcctgaaaggaaggcctgcttgctgccactcagaaacagtggtctga

DBGET integrated database retrieval system