KEGG   Myotis davidii: 102769680Help
Entry
102769680         CDS       T02992                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
myd  Myotis davidii
Pathway
myd00052  Galactose metabolism
myd00500  Starch and sucrose metabolism
myd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102769680 (GANC)
   00500 Starch and sucrose metabolism
    102769680 (GANC)
Enzymes [BR:myd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102769680 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 102769680
NCBI-ProteinID: XP_006778117
LinkDB All DBs
Position
Un
AA seq 908 aa AA seqDB search
MEVSEKEEISVEDEAVDKNIFKNCSKIAFYRRQKQQLSKKSTYQALLDSVTTGKDSIRFQ
IINEATKVPLLAEVFGIEGNIFRLKINEETPLKPRYEVPDVITSKPSTVRLTSSSVDTSN
LILADEKGDLKCHITANPFKVDLVSKEEVVMSINSLGQLYFEHLQIPFEQRATREKENES
IDTSQKNQEDLGLWEEKFGKFVDVKLNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNTG
GEDAYRLYNLDVYGYEIHNKMGIYGSVPYLLAHKLGRTLGIFWLNASETIVEINTEPAVK
MGPADAKQKSKSRTDVHWMSESGIIDVFLLTGPTPFDVFKQYSSLTGTQAMPPLFSLGYH
QCRWNYEDEQDVKAVDAGFDKHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKRMQELLR
NKKRKLVVISDPHIKIDPDYSVYATAQEKGYFVRNHEGGDFEGICWPGLSSYLDFTNPKV
REWYAGLFAFSVYQGSTDILYIWNDMNEPSVFRGPEQTMQKNAIHHGNWEHRELHNIYGF
YQQKATAEGLIQRSRGKERPFVLTRSFFAGSQKYGAVWTGDNRAKWSYLKISIPMLLTLS
VTGISFCGADVGGFVGDPEVELLVRWYQAGAYQPFFRGHSTVNSKRREPWLFGKEHTQLI
REAIRERYTLLPYWYCLFYCAHVTAEPIMRPLWVEFPDELETFGVEDEYMLGSALLVHPV
TEPKATVVDVFLPGSSEVWYDSKTFASWEGACTVKIPVALDTIPVFQRGGSVVPIKTTIG
KSTGWMTDSPYGLRVALSTKGSAVGELYLDDGHSFQYLQKQQFLHRKFCFCSGVLSNSCA
DERGHYTSKCEVEQIFVLGLKKQPSSVTTHSSDGKDQPVAFTYCAGTSTLSLENLSLNIG
TDWEVHIK
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttccgaaaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaaaactgcagcaagattgctttctacaggcgtcagaaacagcagctctccaagaag
tccacctatcaggcattactagactcagtcacaacaggcaaagacagcatcaggttccaa
atcatcaatgaagcaactaaggttcctcttttggctgaagtttttggtatagagggaaat
attttcaggcttaaaatcaatgaagaaactccgctgaagcccaggtatgaagtcccagat
gtcatcacaagcaaaccaagtactgtaaggctgacttcatcctcagtagatacaagcaat
ctcatattggcagatgaaaaaggagatctaaagtgtcatatcacggctaacccattcaaa
gtagacttggtgtctaaagaagaggttgtgatgagcataaactccctgggccaattgtat
tttgagcatctgcagattcctttcgagcaaagagctaccagagaaaaggagaatgaatca
atcgacacctctcagaaaaatcaagaggatctaggcctatgggaggagaaatttggaaaa
tttgtggatgtcaaacttaatggtcctgcctccattggtttggatttctccttgcatgga
tttgagcatctctatgggatcccacaacatgcagaatcacatcaacttaaaaatactggt
ggtgaggatgcttaccgtctttataacctggatgtctatggatatgaaatacataacaaa
atgggcatttatggttcagtgccttatctcttggcccacaaactgggtaggactttgggc
attttttggctgaatgcttcagaaacaatagtggagatcaatacagagcctgcagtaaag
atgggcccagctgatgctaaacaaaagagcaaatctcgaactgatgtgcattggatgtca
gagagtggaatcattgatgtttttctgctgacagggcctacaccttttgatgtcttcaag
cagtactcatctcttacaggcacacaagccatgccccctctcttctccttggggtaccac
cagtgccgctggaactatgaagatgagcaggatgtaaaagcagtggatgcaggatttgac
aaacatgacattccttatgatgtcatgtggctggacatagagcacaccgagggcaaaagg
tacttcacctgggacaagaaaagattccccaaccccaaaaggatgcaggagctgctccga
aacaaaaaacgcaagcttgtggtcatcagtgacccgcatatcaagattgatcctgactac
tcagtgtacgctacggcccaagaaaagggctactttgtgaggaatcatgaagggggagac
tttgaagggatatgttggccaggtctctcctcttacctggatttcaccaaccccaaggtc
agagagtggtatgcaggtctttttgctttttctgtttatcagggatctactgacatcctc
tacatatggaatgacatgaatgagccctcggtctttagagggccagagcaaaccatgcag
aagaatgccattcatcatggcaactgggagcacagagaacttcacaacatctatggcttt
tatcagcaaaaggctactgcagaaggactgatacaacgatctaggggaaaggagagaccc
tttgttcttacacgctctttctttgctggatcacaaaagtatggtgctgtgtggacaggc
gacaacagagcaaaatggagttacctgaaaatttccatccctatgttactcactctcagc
gttactgggatctctttttgtggagctgatgttggtggcttcgtgggggatccagaggtg
gagctgctagtgcgttggtaccaggctggagcctaccagcccttctttcgtggccattcc
accgtaaacagcaagcgacgggaaccctggctctttgggaaggaacacacccagctcatc
agagaagccatcagagagcgttacaccctcctgccctattggtattgtctgttctactgt
gcacacgtgactgccgaacccatcatgaggcctctgtgggtagagttccctgatgaatta
gagacttttggtgtggaagatgaatacatgctgggaagtgctttattggttcatccagtc
acagagccaaaagctactgtggttgatgtgtttctgccaggatcaagtgaggtctggtat
gactctaagacatttgcttcttgggaaggagcatgcactgtgaagatcccagtagccttg
gacactataccagtgtttcaacgaggtggaagtgtagtgcctataaagacaactatagga
aaatccacaggctggatgactgattccccatatggactccgggtggctctaagcactaag
ggttctgcggtgggtgaattgtatctcgatgatggccattctttccaatacctccaaaag
cagcaattcttacacaggaagttttgtttctgttcaggtgttttgagcaacagttgtgct
gatgagaggggtcattataccagcaagtgtgaggtggagcagatctttgtcctaggcctc
aagaagcagccatcttctgtgaccacccactcatctgatggtaaagatcagcctgtggct
tttacgtattgtgccggaacatccaccctgagcctggagaacctctcgctgaacattggc
actgactgggaggtccacattaagtga

DBGET integrated database retrieval system