Myotis davidii (David's myotis): 102769803 Help Entry 102769803         CDS       T02992                                  Symbol IL1B Name (RefSeq) interleukin 1 beta   KO K04519   interleukin 1 beta Organism myd  Myotis davidii (David's myotis) Pathway myd01523   Antifolate resistance myd04010   MAPK signaling pathway myd04060   Cytokine-cytokine receptor interaction myd04064   NF-kappa B signaling pathway myd04217   Necroptosis myd04380   Osteoclast differentiation myd04620   Toll-like receptor signaling pathway myd04621   NOD-like receptor signaling pathway myd04623   Cytosolic DNA-sensing pathway myd04625   C-type lectin receptor signaling pathway myd04640   Hematopoietic cell lineage myd04657   IL-17 signaling pathway myd04659   Th17 cell differentiation myd04668   TNF signaling pathway myd04750   Inflammatory mediator regulation of TRP channels myd04932   Non-alcoholic fatty liver disease myd04933   AGE-RAGE signaling pathway in diabetic complications myd04936   Alcoholic liver disease myd04940   Type I diabetes mellitus myd05010   Alzheimer disease myd05020   Prion disease myd05022   Pathways of neurodegeneration - multiple diseases myd05132   Salmonella infection myd05133   Pertussis myd05134   Legionellosis myd05135   Yersinia infection myd05140   Leishmaniasis myd05142   Chagas disease myd05143   African trypanosomiasis myd05144   Malaria myd05146   Amoebiasis myd05152   Tuberculosis myd05162   Measles myd05163   Human cytomegalovirus infection myd05164   Influenza A myd05168   Herpes simplex virus 1 infection myd05171   Coronavirus disease - COVID-19 myd05321   Inflammatory bowel disease myd05323   Rheumatoid arthritis myd05332   Graft-versus-host disease myd05417   Lipid and atherosclerosis myd05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102769803 (IL1B)    04064 NF-kappa B signaling pathway     102769803 (IL1B)    04668 TNF signaling pathway     102769803 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102769803 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102769803 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102769803 (IL1B)    04620 Toll-like receptor signaling pathway     102769803 (IL1B)    04621 NOD-like receptor signaling pathway     102769803 (IL1B)    04623 Cytosolic DNA-sensing pathway     102769803 (IL1B)    04625 C-type lectin receptor signaling pathway     102769803 (IL1B)    04659 Th17 cell differentiation     102769803 (IL1B)    04657 IL-17 signaling pathway     102769803 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102769803 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     102769803 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102769803 (IL1B)    05164 Influenza A     102769803 (IL1B)    05162 Measles     102769803 (IL1B)    05168 Herpes simplex virus 1 infection     102769803 (IL1B)    05163 Human cytomegalovirus infection     102769803 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     102769803 (IL1B)    05135 Yersinia infection     102769803 (IL1B)    05133 Pertussis     102769803 (IL1B)    05134 Legionellosis     102769803 (IL1B)    05152 Tuberculosis     102769803 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     102769803 (IL1B)    05144 Malaria     102769803 (IL1B)    05140 Leishmaniasis     102769803 (IL1B)    05142 Chagas disease     102769803 (IL1B)    05143 African trypanosomiasis     102769803 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     102769803 (IL1B)    05321 Inflammatory bowel disease     102769803 (IL1B)    05332 Graft-versus-host disease     102769803 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102769803 (IL1B)    05020 Prion disease     102769803 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     102769803 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102769803 (IL1B)    05418 Fluid shear stress and atherosclerosis     102769803 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102769803 (IL1B)    04936 Alcoholic liver disease     102769803 (IL1B)    04932 Non-alcoholic fatty liver disease     102769803 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     102769803 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102769803 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102769803 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:myd00536]     102769803 (IL1B) Cytokines and neuropeptides [BR:myd04052]  Cytokines   Interleukins    102769803 (IL1B) Glycosaminoglycan binding proteins [BR:myd00536]  Heparan sulfate / Heparin   Cytokines    102769803 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  102769803 NCBI-ProteinID:  XP_006765734 LinkDB All DBs Position Un AA seq 268 aa AA seqDB search MAAVPELANEVMVYYSDNENDLFFEADGPQQTKGSFQDLDLSPLGDGGIQLKVSHQLYNS SFRRAVSIVVAVEKLRKVPMVCPQDFQDDDLRSLFFFIFKEESIDCMWDGSYECDASLQS LQCRLRDINQKSLVLSGPHELQALHLNGQDVNQQVVFCMSFVPGDENIDKIPVALGIKEK NLYLSCVVKDKKPTLQLETFDPHGQSKKKIDRRFIFHKKEIRDKVEFESAMYPNWYISTS QADQTPVFLGSTKGGQDITDFTMEILTH NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtgcctgaactcgccaatgaagtgatggtttactacagtgacaatgagaat gacctgttctttgaggctgacggcccacaacagactaagggctccttccaagacctggac ctcagccctctgggagatgggggcatccagctgaaagtctcccaccagctctacaactcc agcttcaggcgggccgtgtcgatcgtcgttgccgtggagaagctgaggaaagtgcccatg gtctgcccacaggacttccaggatgacgacctgcggagcctcttcttcttcatcttcaaa gaagaatccatcgactgcatgtgggatggcagttacgagtgtgatgcatccctacaatcg ctgcagtgcaggctccgggacataaaccaaaaatccctggtgctgtctggaccacatgag ctgcaggctcttcacctgaatggacaggatgtgaaccaacaagtggtgttctgcatgagc ttcgtgccaggagatgagaatatcgacaagatacccgtggccttgggcatcaaggaaaag aacctgtacttgtcttgcgtggtgaaggacaagaagcccaccctgcagctggagacattt gacccccacggtcagtcaaagaagaagatagacaggcgatttatcttccacaagaaagaa atcagggacaaggtagaatttgagtctgccatgtaccccaactggtacatcagcacctcg caagcggaccagacgcccgtcttcctgggaagtactaaaggtggccaggatataactgac ttcaccatggaaatcctgactcactga

DBGET integrated database retrieval system