KEGG   Myotis davidii: 102770704
Entry
102770704         CDS       T02992                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
myd  Myotis davidii
Pathway
myd01523  Antifolate resistance
myd04010  MAPK signaling pathway
myd04014  Ras signaling pathway
myd04024  cAMP signaling pathway
myd04062  Chemokine signaling pathway
myd04064  NF-kappa B signaling pathway
myd04066  HIF-1 signaling pathway
myd04071  Sphingolipid signaling pathway
myd04137  Mitophagy - animal
myd04151  PI3K-Akt signaling pathway
myd04210  Apoptosis
myd04211  Longevity regulating pathway
myd04218  Cellular senescence
myd04380  Osteoclast differentiation
myd04620  Toll-like receptor signaling pathway
myd04621  NOD-like receptor signaling pathway
myd04622  RIG-I-like receptor signaling pathway
myd04623  Cytosolic DNA-sensing pathway
myd04625  C-type lectin receptor signaling pathway
myd04657  IL-17 signaling pathway
myd04658  Th1 and Th2 cell differentiation
myd04659  Th17 cell differentiation
myd04660  T cell receptor signaling pathway
myd04662  B cell receptor signaling pathway
myd04668  TNF signaling pathway
myd04722  Neurotrophin signaling pathway
myd04917  Prolactin signaling pathway
myd04920  Adipocytokine signaling pathway
myd04926  Relaxin signaling pathway
myd04931  Insulin resistance
myd04932  Non-alcoholic fatty liver disease
myd04933  AGE-RAGE signaling pathway in diabetic complications
myd05010  Alzheimer disease
myd05022  Pathways of neurodegeneration - multiple diseases
myd05030  Cocaine addiction
myd05132  Salmonella infection
myd05133  Pertussis
myd05134  Legionellosis
myd05135  Yersinia infection
myd05140  Leishmaniasis
myd05142  Chagas disease
myd05145  Toxoplasmosis
myd05146  Amoebiasis
myd05152  Tuberculosis
myd05160  Hepatitis C
myd05161  Hepatitis B
myd05162  Measles
myd05163  Human cytomegalovirus infection
myd05164  Influenza A
myd05165  Human papillomavirus infection
myd05166  Human T-cell leukemia virus 1 infection
myd05167  Kaposi sarcoma-associated herpesvirus infection
myd05168  Herpes simplex virus 1 infection
myd05169  Epstein-Barr virus infection
myd05170  Human immunodeficiency virus 1 infection
myd05200  Pathways in cancer
myd05202  Transcriptional misregulation in cancer
myd05203  Viral carcinogenesis
myd05212  Pancreatic cancer
myd05215  Prostate cancer
myd05220  Chronic myeloid leukemia
myd05221  Acute myeloid leukemia
myd05222  Small cell lung cancer
myd05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
myd05321  Inflammatory bowel disease
myd05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102770704 (RELA)
   04014 Ras signaling pathway
    102770704 (RELA)
   04064 NF-kappa B signaling pathway
    102770704 (RELA)
   04668 TNF signaling pathway
    102770704 (RELA)
   04066 HIF-1 signaling pathway
    102770704 (RELA)
   04071 Sphingolipid signaling pathway
    102770704 (RELA)
   04024 cAMP signaling pathway
    102770704 (RELA)
   04151 PI3K-Akt signaling pathway
    102770704 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102770704 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102770704 (RELA)
   04218 Cellular senescence
    102770704 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102770704 (RELA)
   04621 NOD-like receptor signaling pathway
    102770704 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102770704 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102770704 (RELA)
   04625 C-type lectin receptor signaling pathway
    102770704 (RELA)
   04660 T cell receptor signaling pathway
    102770704 (RELA)
   04658 Th1 and Th2 cell differentiation
    102770704 (RELA)
   04659 Th17 cell differentiation
    102770704 (RELA)
   04657 IL-17 signaling pathway
    102770704 (RELA)
   04662 B cell receptor signaling pathway
    102770704 (RELA)
   04062 Chemokine signaling pathway
    102770704 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102770704 (RELA)
   04917 Prolactin signaling pathway
    102770704 (RELA)
   04926 Relaxin signaling pathway
    102770704 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102770704 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102770704 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    102770704 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102770704 (RELA)
   05202 Transcriptional misregulation in cancer
    102770704 (RELA)
   05203 Viral carcinogenesis
    102770704 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102770704 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102770704 (RELA)
   05221 Acute myeloid leukemia
    102770704 (RELA)
   05220 Chronic myeloid leukemia
    102770704 (RELA)
   05215 Prostate cancer
    102770704 (RELA)
   05222 Small cell lung cancer
    102770704 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102770704 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102770704 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    102770704 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    102770704 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102770704 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102770704 (RELA)
   04931 Insulin resistance
    102770704 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102770704 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102770704 (RELA)
   05135 Yersinia infection
    102770704 (RELA)
   05133 Pertussis
    102770704 (RELA)
   05134 Legionellosis
    102770704 (RELA)
   05152 Tuberculosis
    102770704 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102770704 (RELA)
   05170 Human immunodeficiency virus 1 infection
    102770704 (RELA)
   05162 Measles
    102770704 (RELA)
   05164 Influenza A
    102770704 (RELA)
   05161 Hepatitis B
    102770704 (RELA)
   05160 Hepatitis C
    102770704 (RELA)
   05168 Herpes simplex virus 1 infection
    102770704 (RELA)
   05163 Human cytomegalovirus infection
    102770704 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102770704 (RELA)
   05169 Epstein-Barr virus infection
    102770704 (RELA)
   05165 Human papillomavirus infection
    102770704 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102770704 (RELA)
   05145 Toxoplasmosis
    102770704 (RELA)
   05140 Leishmaniasis
    102770704 (RELA)
   05142 Chagas disease
    102770704 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102770704 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myd03000]
    102770704 (RELA)
Transcription factors [BR:myd03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102770704 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102770704
NCBI-ProteinID: XP_015424455
LinkDB
Position
Un
AA seq 633 aa
PVRGGGARLSFPFGSGWEVPPAGVLKESRKALTQFPRVEGDRHPRVPREQVSWLLSRPEF
RPVPRERALPQFPWGSWEGACADPFLPPLSDLFPLIFPSEPAQAPGPYVEIIEQPKQRGM
RFRYKCEGRSAGSIPGERSTDTTKTHPTIKIIGYTGPGTVRISLVTKDPPHRPHPHELVG
KDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPMEEQRGDY
DLNAVRLCFQVTVRDPSGRPLRLSPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEI
FLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQL
RRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDPRPPPRRIA
VPSRSSASVPKPAPQPYPFTPSLSTINFEEFSPMVFSSGQIPNQPSGLAPALVSAMAPAL
VQGPAPAPVPVIASASSLAQAVAPPAPKPTQAGEGTLTEALLHLQFDADEDLGALLGNNT
DPAVFTDLASVDNSEFQQMLNQGVSMAPHTAEPMLMEYPEAITRLVTGSQNPPDPAPAPL
GAAGLANGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1902 nt   +upstreamnt  +downstreamnt
cctgttcggggaggaggtgcccgactcagtttccccttcggatccgggtgggaggtgccg
cctgccggtgtccttaaggaaagtagaaaggccctgactcagtttccccgagtagagggc
gaccgccatccccgtgttccccgggagcaggtgtcctggctcctctcccgccctgagttc
cgccccgtcccccgggagcgggccctgcctcagtttccctgggggagctgggaaggggct
tgtgctgacccttttctccctcccctttcagacctgttccccctcatcttcccctccgag
cccgcccaggccccgggcccctacgtggagatcatcgagcagcccaagcagcggggcatg
cgcttccgctacaagtgcgagggccgctcggcgggcagtatccccggcgagaggagcacc
gataccaccaagacccaccccaccattaagatcattggctacacggggccggggacggtt
cgcatctctctggtcaccaaggaccccccgcaccggcctcacccccacgagctggtcggg
aaagactgccgggatggcttctatgaggccgagctctgcccggaccgctgcatccacagc
ttccagaacctggggatccaatgtgtgaagaagcgggacctggagcaggccatcagtcag
cgcatccagaccaacaacaaccccttccaagttcccatggaagagcagcgcggagactac
gacttgaatgctgtgcggctctgcttccaggtgacagtgcgggacccatcaggcaggccc
ctccgcctgtcacctgtcctctctcatcccatctttgacaaccgcgcccccaacacagca
gagctcaagatctgccgagtgaaccgaaactcggggagctgcctcgggggggacgagatc
ttcctgctgtgtgacaaggtgcagaaagaggacatcgaagtgtatttcacgggaccaggc
tgggaggcccgaggttccttttcacaagccgatgtacaccgacaagtggccattgtgttc
cggacacctccctacgcagacccaagcctgcaggcccccgtgcgcgtctccatgcagctg
cggcggccttcagatcgggagctcagcgagcccatggaattccagtacttaccagacaca
gatgatcgtcaccggattgaggagaagcgcaaaaggacatatgagaccttcaagagcatc
atgaagaagagtcctttcaatggacccaccgacccccggcctcctccccggcgcattgcc
gtgccttcccgcagctcagcttccgtccctaagccagctccccagccctatccctttacg
ccatccctcagcaccatcaactttgaggagttttcccccatggtcttttcttctgggcag
atcccaaaccagccctcaggcttggcaccagcccttgtctcagccatggcaccagctctg
gttcagggcccagccccagcccctgtcccagtcatagcctcagcctccagccttgctcag
gctgtggccccgcctgcccccaagcccacccaggcaggggaaggaacactgacggaggcc
ctgctacatctgcagtttgatgctgatgaagacctgggggccctgctgggcaataatact
gacccagccgtgttcacggacctggcctccgtcgacaactctgagtttcagcagatgctg
aaccagggtgtctctatggctccccacacagcggagcccatgctgatggagtaccctgag
gctataacacgcctggtgacagggtcccagaatccccctgacccagctcctgctcccctg
ggggccgctggcctcgccaacggcctcctctcaggggatgaagacttttcctccatcgca
gacatggacttctcagccctactgagtcaaatcagctcctaa

DBGET integrated database retrieval system