Myotis davidii (David's myotis): 102771095 Help Entry 102771095         CDS       T02992                                  Symbol CENPX, STRA13 Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism myd  Myotis davidii (David's myotis) Pathway myd03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:myd00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     102771095 (CENPX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:myd03400]     102771095 (CENPX) DNA repair and recombination proteins [BR:myd03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      102771095 (CENPX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  102771095 NCBI-ProteinID:  XP_015415549 LinkDB All DBs Position Un AA seq 115 aa AA seqDB search MIGWMRAGGAKVRRPYSSLAGSAGAGLRGAHATVAVMEGTSACFRKELVSKLLHLHFEDE RTKVSGDALLLLAELLKVFVVEATVRSIRQAQAEDLPTVDVEQLEKVLPQLLLDF NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgattggctggatgcgtgcaggtggagctaaagtgaggcgcccttatagctcattggct gggagcgcgggggcggggctccgaggagcgcacgcgacggtggcggtcatggagggaacc agcgcctgcttccggaaggaactggtgagcaagctgctgcacctgcacttcgaggacgag aggaccaaagtcagcggggacgcgctgctgctcctcgccgagctgctcaaggtatttgtc gtggaggccaccgtccgcagcatcaggcaggcccaggcggaggacctgcccactgtggac gtggaacagctggagaaggtgctgccgcagctgcttctggacttctag

DBGET integrated database retrieval system