KEGG   Myotis davidii: 102771621Help
Entry
102771621         CDS       T02992                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
myd  Myotis davidii
Pathway
myd00020  Citrate cycle (TCA cycle)
myd00190  Oxidative phosphorylation
myd01100  Metabolic pathways
myd01200  Carbon metabolism
myd04714  Thermogenesis
myd04932  Non-alcoholic fatty liver disease (NAFLD)
myd05010  Alzheimer disease
myd05012  Parkinson disease
myd05016  Huntington disease
Module
myd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
myd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
myd_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102771621
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102771621
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102771621
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102771621
   05012 Parkinson disease
    102771621
   05016 Huntington disease
    102771621
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102771621
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102771621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9
Motif
Other DBs
NCBI-GeneID: 102771621
NCBI-ProteinID: XP_015413151
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAVARVSLRRRFPAAALGGACLQACRGAQTAAVTASRIKKFAIYRWDPDKTGDKPRMQT
YEIDLNKCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDRDKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQNPFSL
YRCRTVMNCTRTCPKGLNPGKAIAEIKKMMVTYKKKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagtggccagagtgtccttgaggcgccggttcccggcagcggccctcggtggt
gcctgcctgcaggcctgccgaggggcccagacagctgctgtcaccgcttcccgaatcaag
aaatttgccatctaccgatgggatccagacaaaactggagataaacctcgtatgcaaact
tatgaaatcgatttgaataaatgtggtcctatggtgttggatgctttaatcaagattaag
aatgaaatggattctaccttgaccttccgaagatcttgcagggaagggatctgtggctcc
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccggaggattgacaccaac
ctcaacaaagtctcaaaaatctaccctcttccacatatgtatgtgataaaggatctggtt
cctgatttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaagaag
gatgaatcccaggaaggcaaacagcagtatctgcagtccatagaagatcgagataaactg
gatgggctgtacgagtgcatcctctgtgcctgctgcagcaccagctgccccagctactgg
tggaatggagacaaatacctgggacctgcggtgctcatgcaggcctatcgctggatgatc
gactccagggacgagttcacggaggagcgcctggccaagttgcagaaccccttctctctc
taccgctgccgcaccgtcatgaactgcacaaggacctgtcccaaggggctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggtaacctacaagaaaaagaaagcttccgct
taa

DBGET integrated database retrieval system