KEGG   Myotis davidii: 102772051
Entry
102772051         CDS       T02992                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
myd  Myotis davidii
Pathway
myd01523  Antifolate resistance
myd04010  MAPK signaling pathway
myd04014  Ras signaling pathway
myd04062  Chemokine signaling pathway
myd04064  NF-kappa B signaling pathway
myd04151  PI3K-Akt signaling pathway
myd04210  Apoptosis
myd04380  Osteoclast differentiation
myd04620  Toll-like receptor signaling pathway
myd04621  NOD-like receptor signaling pathway
myd04622  RIG-I-like receptor signaling pathway
myd04623  Cytosolic DNA-sensing pathway
myd04625  C-type lectin receptor signaling pathway
myd04657  IL-17 signaling pathway
myd04658  Th1 and Th2 cell differentiation
myd04659  Th17 cell differentiation
myd04660  T cell receptor signaling pathway
myd04662  B cell receptor signaling pathway
myd04668  TNF signaling pathway
myd04920  Adipocytokine signaling pathway
myd05132  Salmonella infection
myd05135  Yersinia infection
myd05142  Chagas disease
myd05145  Toxoplasmosis
myd05160  Hepatitis C
myd05161  Hepatitis B
myd05162  Measles
myd05163  Human cytomegalovirus infection
myd05164  Influenza A
myd05165  Human papillomavirus infection
myd05166  Human T-cell leukemia virus 1 infection
myd05167  Kaposi sarcoma-associated herpesvirus infection
myd05168  Herpes simplex virus 1 infection
myd05169  Epstein-Barr virus infection
myd05170  Human immunodeficiency virus 1 infection
myd05200  Pathways in cancer
myd05203  Viral carcinogenesis
myd05212  Pancreatic cancer
myd05215  Prostate cancer
myd05220  Chronic myeloid leukemia
myd05221  Acute myeloid leukemia
myd05222  Small cell lung cancer
myd05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
myd05340  Primary immunodeficiency
myd05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102772051 (IKBKG)
   04014 Ras signaling pathway
    102772051 (IKBKG)
   04064 NF-kappa B signaling pathway
    102772051 (IKBKG)
   04668 TNF signaling pathway
    102772051 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102772051 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102772051 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102772051 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102772051 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102772051 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102772051 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102772051 (IKBKG)
   04660 T cell receptor signaling pathway
    102772051 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102772051 (IKBKG)
   04659 Th17 cell differentiation
    102772051 (IKBKG)
   04657 IL-17 signaling pathway
    102772051 (IKBKG)
   04662 B cell receptor signaling pathway
    102772051 (IKBKG)
   04062 Chemokine signaling pathway
    102772051 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102772051 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102772051 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102772051 (IKBKG)
   05203 Viral carcinogenesis
    102772051 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102772051 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102772051 (IKBKG)
   05221 Acute myeloid leukemia
    102772051 (IKBKG)
   05220 Chronic myeloid leukemia
    102772051 (IKBKG)
   05215 Prostate cancer
    102772051 (IKBKG)
   05222 Small cell lung cancer
    102772051 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102772051 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102772051 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102772051 (IKBKG)
   05135 Yersinia infection
    102772051 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102772051 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102772051 (IKBKG)
   05162 Measles
    102772051 (IKBKG)
   05164 Influenza A
    102772051 (IKBKG)
   05161 Hepatitis B
    102772051 (IKBKG)
   05160 Hepatitis C
    102772051 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102772051 (IKBKG)
   05163 Human cytomegalovirus infection
    102772051 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102772051 (IKBKG)
   05169 Epstein-Barr virus infection
    102772051 (IKBKG)
   05165 Human papillomavirus infection
    102772051 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102772051 (IKBKG)
   05142 Chagas disease
    102772051 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102772051 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myd01001]
    102772051 (IKBKG)
Protein kinases [BR:myd01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102772051 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Golgin_A5
Other DBs
NCBI-GeneID: 102772051
NCBI-ProteinID: XP_006754835
LinkDB
Position
Un
AA seq 414 aa
MSRPPWKSPLCEMVQPSGGPAGDQDMMGEESSLGKPTMLHLPSEQGAPETFQRCLEENQE
LRDAIRQSNQMLRECCEELQRFQGSQREEKEFLMQKFQEARKLVERLNLEKLDLKRQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALESRVRAASEQ
ARKLESEREVLQQQHSVQVDQLRMQNQNMEAALRKERQVASEEKRKLAQLQAAYHQLFQD
YDNRMKSSLVSTERNRGMQLEDLKQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPV
LKAQADIYEADFQAERQAREKLAEKKELLQEQLEQLQREYSRLKASCQESARIEDMRKRH
VEVSQPPAQAHQSFHPAFIQRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIQ
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtccgctgtgtgagatggtgcagcccagcggtggcccg
gctggggaccaggacatgatgggtgaggagtcttctctggggaagccgaccatgctccac
ctgccttcggagcagggtgctcctgagaccttccagcgctgcctggaggagaaccaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagtgctgcgaggagctgcag
cgtttccagggcagccagagggaagagaaggagttcctcatgcagaagttccaggaggcc
aggaaactggtggagagactgaacctggagaagctggacctgaagaggcagagggagcag
gccctacaggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tcggtgaaagcccaggtgacgtccttgctgggggagctccaggagagccagagtcgcttg
gaggctgccaccaaggatcggcaggctttggaatccagggtccgggcagccagtgagcag
gcccggaagctggagagcgagcgggaggtgctgcagcagcagcacagcgtgcaggtggac
cagttgcgcatgcagaaccagaacatggaggctgctctgcgcaaggagcgccaggttgcc
tcggaggagaagcggaagctggcgcagctccaggcagcctatcaccagctcttccaagat
tatgacaaccgcatgaagagcagcctggtgagcactgagcgaaaccgaggaatgcagctg
gaagatctcaagcagcagctccagcaggccgaggaggccctggtggctaagcaagaattg
atcgataagctgaaggaagaggccgagcagcacaagattgtgatggagaccgttccggtg
ctcaaggcccaggcggatatctacgaggctgatttccaggctgagcggcaggcccgggag
aagctggccgagaagaaggagctgctgcaggagcagctggagcagctgcagcgggagtac
agcaggttgaaggccagctgccaggagtcggccaggattgaagatatgaggaagcggcat
gtagaggtctcccagccccctgcccaagctcaccagtcctttcaccccgcgttcatccag
agaagtccccccgaggagccacctgacttctgttgccccaaatgccagtatcaggctcct
gacatggacaccctgcagatccacgtcatggagtgcattcagtag

DBGET integrated database retrieval system