KEGG   Myotis davidii: 102772803
Entry
102772803         CDS       T02992                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
myd  Myotis davidii
Pathway
myd04014  Ras signaling pathway
myd04390  Hippo signaling pathway
myd04392  Hippo signaling pathway - multiple species
myd05200  Pathways in cancer
myd05206  MicroRNAs in cancer
myd05219  Bladder cancer
myd05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102772803 (RASSF1)
   04390 Hippo signaling pathway
    102772803 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    102772803 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102772803 (RASSF1)
   05206 MicroRNAs in cancer
    102772803 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    102772803 (RASSF1)
   05223 Non-small cell lung cancer
    102772803 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH
Other DBs
NCBI-GeneID: 102772803
NCBI-ProteinID: XP_015423830
LinkDB
Position
Un
AA seq 207 aa
MSLNKDGSYTGFIKVQLKLVRPVSVPASKRPPTLQDARRGPGRSTAVRRRTSFYLPKDAV
KHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLSDDEQPLRLRLL
AGPNEKALSFVLKENDSGEVNACWFGHACCSLCHPSSLQWDAFSMPELHNFLRILQREEE
EHLRQILQKYSCCRQKIQEALHACPLG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagcctgaacaaggacggctcctacacaggcttcatcaaggtgcagctgaagctggtg
cgccctgtctccgtgcctgccagcaagaggccgcccaccttgcaggacgcccggcggggc
ccagggcggagcacagccgtgaggcgccgcacctccttctacctgcccaaggatgctgtc
aagcacctgcacgtgttgtcacgcacgcgggcacgcgaggtcatcgaggccctgctgcgc
aagttcttggtggtggacgacccccgcaagttcgcactctttgagcgggctgagcgccac
ggccaagtgtacctccggaagctgtcggatgatgagcagcccctgcggctacgactcctt
gcggggcccaacgagaaggccctgagcttcgtgctgaaggagaatgactctggggaggtg
aacgcctgctggtttggccatgcctgctgcagcctttgccacccctcctccctgcagtgg
gatgccttcagcatgcctgagctccacaacttcctgcgcatcctacagcgggaggaagag
gaacacctccgccagatcctgcagaagtactcctgttgccgccagaagatccaggaggcc
ctgcatgcctgccccctggggtga

DBGET integrated database retrieval system