KEGG   Myotis davidii: 102773038
Entry
102773038         CDS       T02992                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
myd  Myotis davidii
Pathway
myd01522  Endocrine resistance
myd01524  Platinum drug resistance
myd04012  ErbB signaling pathway
myd04066  HIF-1 signaling pathway
myd04068  FoxO signaling pathway
myd04110  Cell cycle
myd04115  p53 signaling pathway
myd04151  PI3K-Akt signaling pathway
myd04218  Cellular senescence
myd04630  JAK-STAT signaling pathway
myd04921  Oxytocin signaling pathway
myd04928  Parathyroid hormone synthesis, secretion and action
myd04934  Cushing syndrome
myd05160  Hepatitis C
myd05161  Hepatitis B
myd05163  Human cytomegalovirus infection
myd05165  Human papillomavirus infection
myd05166  Human T-cell leukemia virus 1 infection
myd05167  Kaposi sarcoma-associated herpesvirus infection
myd05169  Epstein-Barr virus infection
myd05200  Pathways in cancer
myd05202  Transcriptional misregulation in cancer
myd05203  Viral carcinogenesis
myd05205  Proteoglycans in cancer
myd05206  MicroRNAs in cancer
myd05210  Colorectal cancer
myd05211  Renal cell carcinoma
myd05212  Pancreatic cancer
myd05213  Endometrial cancer
myd05214  Glioma
myd05215  Prostate cancer
myd05216  Thyroid cancer
myd05217  Basal cell carcinoma
myd05218  Melanoma
myd05219  Bladder cancer
myd05220  Chronic myeloid leukemia
myd05222  Small cell lung cancer
myd05223  Non-small cell lung cancer
myd05224  Breast cancer
myd05225  Hepatocellular carcinoma
myd05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102773038 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102773038 (CDKN1A)
   04066 HIF-1 signaling pathway
    102773038 (CDKN1A)
   04068 FoxO signaling pathway
    102773038 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102773038 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102773038 (CDKN1A)
   04115 p53 signaling pathway
    102773038 (CDKN1A)
   04218 Cellular senescence
    102773038 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102773038 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102773038 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102773038 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102773038 (CDKN1A)
   05206 MicroRNAs in cancer
    102773038 (CDKN1A)
   05205 Proteoglycans in cancer
    102773038 (CDKN1A)
   05203 Viral carcinogenesis
    102773038 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102773038 (CDKN1A)
   05212 Pancreatic cancer
    102773038 (CDKN1A)
   05225 Hepatocellular carcinoma
    102773038 (CDKN1A)
   05226 Gastric cancer
    102773038 (CDKN1A)
   05214 Glioma
    102773038 (CDKN1A)
   05216 Thyroid cancer
    102773038 (CDKN1A)
   05220 Chronic myeloid leukemia
    102773038 (CDKN1A)
   05217 Basal cell carcinoma
    102773038 (CDKN1A)
   05218 Melanoma
    102773038 (CDKN1A)
   05211 Renal cell carcinoma
    102773038 (CDKN1A)
   05219 Bladder cancer
    102773038 (CDKN1A)
   05215 Prostate cancer
    102773038 (CDKN1A)
   05213 Endometrial cancer
    102773038 (CDKN1A)
   05224 Breast cancer
    102773038 (CDKN1A)
   05222 Small cell lung cancer
    102773038 (CDKN1A)
   05223 Non-small cell lung cancer
    102773038 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102773038 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102773038 (CDKN1A)
   05161 Hepatitis B
    102773038 (CDKN1A)
   05160 Hepatitis C
    102773038 (CDKN1A)
   05163 Human cytomegalovirus infection
    102773038 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102773038 (CDKN1A)
   05169 Epstein-Barr virus infection
    102773038 (CDKN1A)
   05165 Human papillomavirus infection
    102773038 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102773038 (CDKN1A)
   01522 Endocrine resistance
    102773038 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102773038
NCBI-ProteinID: XP_006759093
UniProt: L5M603
LinkDB
Position
Un
AA seq 164 aa
MSEPSRDARPIPRGSRACRRLFGPVDSEQLQRDCDALMASCVQEACDRWNFDFVTETPLE
GDFAWERVWSLDLPKVYLPPAPRRAQDSLGRSKRASSSPALLQGPAQEDHVDLSLSCTLV
PRSPEQPEASPGGPSTSQGRKRRQTSMTDFYHSKRRLIFSKRRP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtccgagccatcccgggatgcccgcccgatcccccgcggcagcagggcctgccgccgc
ctgttcggccccgtggacagtgagcagctgcagcgagactgcgatgctctgatggccagc
tgcgtgcaggaggcctgtgatcgatggaacttcgactttgtcaccgagacaccgctggag
ggtgacttcgcctgggagcgggtgtggagcctggacctgcccaaggtctacctgccccca
gcgccgaggagggcccaggacagcctggggagaagcaagcgggccagcagctcacctgcc
ctgctgcaggggccagctcaggaggaccacgtggacctgtcactgtcctgcaccctggtg
ccacgctcccctgagcagcctgaggcgtccccaggtgggccgagcacgtctcagggccgc
aaacggcggcagaccagcatgacagatttttatcactccaaacgccggctgatcttctcc
aagaggaggccctaa

DBGET integrated database retrieval system