KEGG   Myotis davidii: 102773442Help
Entry
102773442         CDS       T02992                                 

Gene name
PARS2
Definition
(RefSeq) prolyl-tRNA synthetase 2, mitochondrial (putative)
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
myd  Myotis davidii
Pathway
myd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102773442 (PARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:myd01007]
    102773442 (PARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:myd03016]
    102773442 (PARS2)
Enzymes [BR:myd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     102773442 (PARS2)
Amino acid related enzymes [BR:myd01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   102773442 (PARS2)
Transfer RNA biogenesis [BR:myd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102773442 (PARS2)
 Prokaryotic type
    102773442 (PARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon Anti-TRAP
Motif
Other DBs
NCBI-GeneID: 102773442
NCBI-ProteinID: XP_006768422
LinkDB All DBs
Position
Un
AA seq 454 aa AA seqDB search
MEGLLTRCRALPALATCNHQLSGYIPRGFSHCAPGRGRRLALSCMFQPQNLREDQVLPVE
GRSGDLTCKSQRLMLQVGLIHPASSGCYHLLPYTVRAMEKLVRVIDQEMQAIGGQKVNMP
SLSPAELWRASNRWDLMGRELLRLRDRHGKEYCLGPTHEEAITARKFRDEPRPRFGLLRG
REFYMKDMYTFDSSPEAAWQTYSLVCDAYGSLFDRLGLRCVKVQADVGSIGGTMSHEFQL
PVEIGEDRFAVCTSCSFSANVETLGSSQMNCPACQGPLTETKGIEVGHTFYLGTKYSSIF
NAQFINIHGKPSLAEMGCYGLGVTRILAAAIEVLSTEDCIRWPSLLAPYQVCLIPPKKGS
KEEVAAELTGQLYDHISEAVPQLRGEILLDDRTHLTIGNRLKDANKFGYPFVIIAGKRAL
EDPAHFEVWCQNTSEVVFLTKEAVIELLSHVQVV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaagggctgctgacaagatgcagagcactgcccgctctggccacctgcaaccaccag
ctctctgggtacattccccgcgggttttcccactgtgccccagggagagggaggcgcttg
gcgctgtcctgcatgttccagccccagaaccttcgggaagaccaggtgctcccagtggag
ggcagatctggcgacctgacctgtaagagccagcggctgatgctgcaggtgggcctgatc
cacccagcaagctccggctgttaccacctcctgccttatactgttcgtgccatggagaag
ctggtgcgggtgatagaccaggagatgcaggccattggcgggcagaaggtcaacatgccc
agcctcagcccagcagagctctggcgagcctccaaccggtgggacttaatgggcagggag
ctgctaagacttagagacagacatggcaaggaatattgcttaggaccaactcatgaggaa
gccattacagctaggaagtttcgggatgagcccaggccccgctttggtcttctccgtggc
cgagagttttacatgaaggacatgtacaccttcgactcctccccagaggccgcctggcag
acctacagcctggtatgtgatgcctacggcagcctgttcgacaggctggggctgcggtgt
gtcaaggtccaggcagacgtgggcagcatcgggggcacgatgtctcacgagttccagctc
ccagtggagatcggagaggaccggtttgctgtctgcaccagctgcagcttctcggccaac
gtggagacgctaggctcgtctcaaatgaactgccctgcttgccagggaccactgactgaa
accaaaggcattgaggtggggcacacgttttacctgggcaccaagtactcctccattttc
aatgcccagtttattaacatccatggcaaaccttccctggctgaaatggggtgctatggc
ttaggtgtgacacggatcttggctgctgccattgaggttctctctacagaagattgcatt
cgctggcctagcctcctggccccttaccaagtctgcctcatccccccgaagaagggcagt
aaggaagaggtggctgcagagctcacggggcagctgtatgaccacatctcagaggcagtg
ccgcagcttcgtggggagatcctactggatgacaggacccatctgaccattggaaacaga
ctgaaggatgccaacaaatttggctacccctttgtgatcatcgctggcaagagggccttg
gaggaccctgcccattttgaggtttggtgccagaacaccagcgaagtggtctttctcacc
aaagaagcagtcatagaattactgagccacgtgcaggtagtctaa

DBGET integrated database retrieval system