KEGG   Myotis davidii: 102773629
Entry
102773629         CDS       T02992                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
myd  Myotis davidii
Pathway
myd04060  Cytokine-cytokine receptor interaction
myd04061  Viral protein interaction with cytokine and cytokine receptor
myd04151  PI3K-Akt signaling pathway
myd04625  C-type lectin receptor signaling pathway
myd04630  JAK-STAT signaling pathway
myd04658  Th1 and Th2 cell differentiation
myd04659  Th17 cell differentiation
myd04660  T cell receptor signaling pathway
myd04672  Intestinal immune network for IgA production
myd04940  Type I diabetes mellitus
myd05135  Yersinia infection
myd05142  Chagas disease
myd05162  Measles
myd05166  Human T-cell leukemia virus 1 infection
myd05200  Pathways in cancer
myd05320  Autoimmune thyroid disease
myd05321  Inflammatory bowel disease
myd05330  Allograft rejection
myd05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102773629 (IL2)
   04151 PI3K-Akt signaling pathway
    102773629 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102773629 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102773629 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102773629 (IL2)
   04660 T cell receptor signaling pathway
    102773629 (IL2)
   04658 Th1 and Th2 cell differentiation
    102773629 (IL2)
   04659 Th17 cell differentiation
    102773629 (IL2)
   04672 Intestinal immune network for IgA production
    102773629 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102773629 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102773629 (IL2)
   05321 Inflammatory bowel disease
    102773629 (IL2)
   05330 Allograft rejection
    102773629 (IL2)
   05332 Graft-versus-host disease
    102773629 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102773629 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102773629 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102773629 (IL2)
   05162 Measles
    102773629 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102773629 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:myd04052]
    102773629 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:myd00536]
    102773629 (IL2)
Cytokines and growth factors [BR:myd04052]
 Cytokines
  Interleukins
   102773629 (IL2)
Glycosaminoglycan binding proteins [BR:myd00536]
 Heparan sulfate / Haparin
  Cytokines
   102773629 (IL2)
SSDB
Motif
Pfam: IL2 Syntaxin_2 DUF773
Other DBs
NCBI-GeneID: 102773629
NCBI-ProteinID: XP_006762896
UniProt: L5LXV5
LinkDB
Position
Un
AA seq 150 aa
MYKMHFLSCIALTLAFIADSAPTSSSSQETQQQLEHLILDMQQLLKRVSNYKNSKLPMML
TFKFYMPRNATELKHLQCLIEEREPLEKVLKLEKSFSNITELISNVNVLVQNLKGPETRF
KCDYDDETVTIVEFLNKWITFCQRIFSTLT
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtacaagatgcacttcttgtcctgtattgcactaactctcgcattcatcgcagacagt
gcacctacctcgagctccagccaggaaacacagcagcagttggagcacctgatactggat
atgcaacagcttctgaagagagtcagcaattacaagaactccaagctccccatgatgctc
acgtttaagttttacatgcccaggaatgccacagaattgaaacatctgcagtgtctaata
gaagaacgtgaacctctggagaaagtgctaaagttagagaaaagcttcagcaatatcacg
gaattaataagcaatgtcaatgtactcgttcagaacctgaagggacctgaaacgagattc
aaatgtgactatgatgatgagacggtgaccatcgtagaattcctgaacaagtggattacc
ttttgtcaaagaatcttctcaacactgacctaa

DBGET integrated database retrieval system