KEGG   Myotis davidii: 102773658Help
Entry
102773658         CDS       T02992                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
myd  Myotis davidii
Pathway
myd04015  Rap1 signaling pathway
myd04310  Wnt signaling pathway
myd04390  Hippo signaling pathway
myd04510  Focal adhesion
myd04520  Adherens junction
myd04550  Signaling pathways regulating pluripotency of stem cells
myd04670  Leukocyte transendothelial migration
myd04916  Melanogenesis
myd04919  Thyroid hormone signaling pathway
myd04934  Cushing syndrome
myd05100  Bacterial invasion of epithelial cells
myd05160  Hepatitis C
myd05163  Human cytomegalovirus infection
myd05165  Human papillomavirus infection
myd05167  Kaposi sarcoma-associated herpesvirus infection
myd05200  Pathways in cancer
myd05205  Proteoglycans in cancer
myd05210  Colorectal cancer
myd05213  Endometrial cancer
myd05215  Prostate cancer
myd05216  Thyroid cancer
myd05217  Basal cell carcinoma
myd05224  Breast cancer
myd05225  Hepatocellular carcinoma
myd05226  Gastric cancer
myd05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
myd05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102773658 (CTNNB1)
   04310 Wnt signaling pathway
    102773658 (CTNNB1)
   04390 Hippo signaling pathway
    102773658 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102773658 (CTNNB1)
   04520 Adherens junction
    102773658 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102773658 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102773658 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102773658 (CTNNB1)
   04916 Melanogenesis
    102773658 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102773658 (CTNNB1)
   05205 Proteoglycans in cancer
    102773658 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102773658 (CTNNB1)
   05225 Hepatocellular carcinoma
    102773658 (CTNNB1)
   05226 Gastric cancer
    102773658 (CTNNB1)
   05216 Thyroid cancer
    102773658 (CTNNB1)
   05217 Basal cell carcinoma
    102773658 (CTNNB1)
   05215 Prostate cancer
    102773658 (CTNNB1)
   05213 Endometrial cancer
    102773658 (CTNNB1)
   05224 Breast cancer
    102773658 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102773658 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102773658 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102773658 (CTNNB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102773658 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102773658 (CTNNB1)
   05163 Human cytomegalovirus infection
    102773658 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102773658 (CTNNB1)
   05165 Human papillomavirus infection
    102773658 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 102773658
NCBI-ProteinID: XP_006770595
LinkDB All DBs
Position
Un
AA seq 786 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHP
TNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLS
KKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGXLAIXXXXXXXX
XXPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLA
ITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKP
AIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDIN
VVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRH
QEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPR
LVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNT
IPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYA
AAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMTWNETADLGLDIGAQGEPLGYRQDDPS
YRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLA
WFDTDL
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaagctgatctgatggagttggacatggccatggagccagacagaaaagcg
gctgttagtcactggcagcagcagtcttacctggactctggaatccattctggtgccact
accacagccccttctctgagcggcaaaggcaatcccgaggaagaagatgtggacaccacc
caacaagtcctgtacgagtgggaacaggggttctctcagtccttcactcaagaacaggta
gcagatattgatggacagtatgcgatgacgcgagctcagcgggtacgagctgctatgttc
cctgagacattagatgagggcatgcagatcccatctacacagttcgatgccgctcatccc
accaacgtccagcgtttggctgaaccgtcacagatgctgaaacatgctgttgtaaatctg
attaactaccaagatgatgcagaacttgccacacgtgcgatcccagaactgacaaaactg
ctgaacgatgaggaccaggtggtggttaataaggctgcagttatggttcatcagctttct
aaaaaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgta
cgtaccatgcagaatacaaatgatgtggaaacagctcgttgcactgctgggaccttgcac
aatctttcccatcatcgggagggcnntctggccatctnnnnnnnnnnnnnnnnnnnnnnn
nnnnnncctgccctggtgaagatgcttggctcaccagtggattctgtattattttatgcc
attacaactctccacaaccttttattgcatcaagaaggagctaaaatggcagtgcgttta
gctggtgggctgcagaaaatggttgctttgctcaacaaaacaaacgttaaattcttggct
attacaacagactgccttcagattttagcttatggcaatcaagaaagcaagctgatcatc
ctggctagtgggggacctcaagctttagtaaacataatgaggacctacacttacgagaag
ctactgtggaccacaagcagagtactgaaggtgttgtctgtctgctctagtaataaaccg
gctattgtagaagctggtggaatgcaagctttaggacttcatctgacagatccgagtcag
cgtcttgttcagaactgtctttggactcttaggaatctctcagatgctgcaactaaacag
gaagggatggaaggtcttcttgggactcttgttcagctgctgggctcagatgatataaat
gtggtcacctgtgcagcgggaatcctttctaatctcacttgcaataattataagaacaag
atgatggtgtgccaagtgggtggtattgaggctcttgtgcgtactgtccttcgtgctggt
gacagggaggacatcactgagcctgccatctgtgctcttcgtcatctgaccagccgacac
caggaagcagagatggcccagaatgctgttcgccttcactatggactaccagttgtggtg
aaactcctacacccaccatcccattggcctctgataaaggctactgttggattgattcga
aatcttgccctttgtccagcaaatcatgcacctctgcgtgaacagggcgccattccacgg
ctagttcagctgctggtgcgtgcacatcaggatacccagcgtcgtacatctatgggcgga
acacagcagcagtttgtggagggtgtccgcatggaagaaatagttgaaggttgtaccgga
gcccttcacatcctagctcgggatgttcacaaccgaatcgtaatcagaggactgaatacc
attccactgtttgtgcagctgctctattctcccattgaaaacatccagagagtagcagcg
ggggtgctctgtgaactcgctcaggacaaggaggcagcagaagctattgaagccgaggga
gccacggcccccctgacagaactgctgcactcgaggaacgagggtgtggcaacgtatgca
gctgctgttctgttccgaatgtctgaggacaagccacaggactataagaagcggctttca
gtggagctgaccagttctctcttcagaacagagccaatgacttggaatgagacggccgat
cttggacttgacattggtgcccagggagagccccttggatatcgccaggatgatcccagc
tatcgttcttttcactctggtggatacggccaggatgccttgggaatggacccaatgatg
gagcatgagatgggtggccaccaccctggtgctgactatccagttgatgggctgccagat
ctggggcacgcccaggacctcatggatgggctgcctccaggtgacagcaatcagctggcc
tggtttgatactgacctgtaa

DBGET integrated database retrieval system