Myotis davidii (David's myotis): 102773748 Help Entry 102773748         CDS       T02992                                  Name (RefSeq) heat shock protein beta-1-like   KO K04455   heat shock protein beta-1 Organism myd  Myotis davidii (David's myotis) Pathway myd04010   MAPK signaling pathway myd04370   VEGF signaling pathway myd05146   Amoebiasis Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102773748    04370 VEGF signaling pathway     102773748  09160 Human Diseases   09174 Infectious disease: parasitic    05146 Amoebiasis     102773748  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:myd03041]     102773748    03110 Chaperones and folding catalysts [BR:myd03110]     102773748   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myd04147]     102773748 Spliceosome [BR:myd03041]  Complex B   U4/U6.U5 tri-snRNP components    U4/U6.U5 tri-snRNP related factors     102773748  Complex C    U4/U6.U5 tri-SnRNP related factors     102773748 Chaperones and folding catalysts [BR:myd03110]  Heat shock proteins   HSP20    102773748 Exosome [BR:myd04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102773748   Exosomal proteins of breast cancer cells    102773748   Exosomal proteins of bladder cancer cells    102773748 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HSP20 YabP Motif Other DBs NCBI-GeneID:  102773748 NCBI-ProteinID:  XP_015413931 LinkDB All DBs Position Un AA seq 137 aa AA seqDB search AAPAYSRXLSRQLSSGISEIQHTPDHWRVSLDVNHFAPEELTVKTKEGVVEISGKQEERQ HEHGYISRCFTRKYTLPPGVDPILVSYSLSPEGTLTVETPMPKPASQSSEITIPVTFEAR AQLGGPGAGKSEQFGTQ NT seq 414 nt NT seq  +upstreamnt  +downstreamnt gctgcgcccgcctacagccgcnggctcagccgacaactcagcagcggcatctccgagatc cagcacacgcccgaccactggcgcgtgtccctggacgtcaaccacttcgcccccgaggag ctgacggtcaagaccaaggaaggcgtggtggagatcagcggcaagcaggaagagagacag catgagcacggctacatttcccgatgcttcactcggaaatacacgcttccccctggtgtg gaccccatcctggtgtcttattccctgtcccctgagggcacgctcaccgtggagaccccg atgcccaagccagccagccagtcatcagagatcaccatccctgtcaccttcgaggctcgt gcccagcttgggggcccaggagctgggaagtccgagcaatttggaacccagtaa

DBGET integrated database retrieval system