KEGG   Myotis davidii: 102773980
Entry
102773980         CDS       T02992                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
myd  Myotis davidii
Pathway
myd04060  Cytokine-cytokine receptor interaction
myd04151  PI3K-Akt signaling pathway
myd04630  JAK-STAT signaling pathway
myd04640  Hematopoietic cell lineage
myd04657  IL-17 signaling pathway
myd04658  Th1 and Th2 cell differentiation
myd04659  Th17 cell differentiation
myd04660  T cell receptor signaling pathway
myd04664  Fc epsilon RI signaling pathway
myd04672  Intestinal immune network for IgA production
myd05140  Leishmaniasis
myd05200  Pathways in cancer
myd05310  Asthma
myd05320  Autoimmune thyroid disease
myd05321  Inflammatory bowel disease
myd05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102773980 (IL4)
   04151 PI3K-Akt signaling pathway
    102773980 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102773980 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102773980 (IL4)
   04660 T cell receptor signaling pathway
    102773980 (IL4)
   04658 Th1 and Th2 cell differentiation
    102773980 (IL4)
   04659 Th17 cell differentiation
    102773980 (IL4)
   04657 IL-17 signaling pathway
    102773980 (IL4)
   04664 Fc epsilon RI signaling pathway
    102773980 (IL4)
   04672 Intestinal immune network for IgA production
    102773980 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102773980 (IL4)
  09163 Immune disease
   05310 Asthma
    102773980 (IL4)
   05320 Autoimmune thyroid disease
    102773980 (IL4)
   05321 Inflammatory bowel disease
    102773980 (IL4)
   05330 Allograft rejection
    102773980 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102773980 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:myd04052]
    102773980 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:myd00536]
    102773980 (IL4)
Cytokines and growth factors [BR:myd04052]
 Cytokines
  Interleukins
   102773980 (IL4)
Glycosaminoglycan binding proteins [BR:myd00536]
 Heparan sulfate / Haparin
  Cytokines
   102773980 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 102773980
NCBI-ProteinID: XP_006759238
UniProt: L5M4Y9
LinkDB
Position
Un
AA seq 137 aa
MGLTSQLIPALICLLACTSNFTHGRNTLQETIKMLNVLTAKKDPRCMELTVSDVLAAPKN
TTENETLCRAATVLRQVYRHHKCLTKILSGLDRNLSSMANKTSCPVNEAKKRTLKDFLER
LKTIMQEKYSKGGSWIF
NT seq 414 nt   +upstreamnt  +downstreamnt
atgggtctcacgtcccaactgattccagctctgatctgcttactagcatgtaccagcaac
ttcacccacggacgcaacaccttacaagagaccatcaaaatgctgaatgtcctcacagcg
aaaaaggatccacggtgtatggagctgaccgtatcagacgtcttggctgccccaaagaac
acaactgagaacgaaaccttgtgcagggccgcgacagtgctccggcaggtctacaggcac
cacaagtgcttgaccaaaatattgagcggacttgacaggaacctcagcagcatggccaac
aagacctcctgtcctgtgaacgaagccaagaagaggacactgaaagacttcttggaaagg
ttaaagaccatcatgcaagagaaatactcaaagggtggaagctggatattttaa

DBGET integrated database retrieval system