KEGG   Myotis davidii: 102774808Help
Entry
102774808         CDS       T02992                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
myd  Myotis davidii
Pathway
myd00590  Arachidonic acid metabolism
myd01100  Metabolic pathways
myd04064  NF-kappa B signaling pathway
myd04370  VEGF signaling pathway
myd04625  C-type lectin receptor signaling pathway
myd04657  IL-17 signaling pathway
myd04668  TNF signaling pathway
myd04723  Retrograde endocannabinoid signaling
myd04726  Serotonergic synapse
myd04913  Ovarian steroidogenesis
myd04921  Oxytocin signaling pathway
myd04923  Regulation of lipolysis in adipocytes
myd05140  Leishmaniasis
myd05163  Human cytomegalovirus infection
myd05165  Human papillomavirus infection
myd05167  Kaposi sarcoma-associated herpesvirus infection
myd05200  Pathways in cancer
myd05204  Chemical carcinogenesis
myd05206  MicroRNAs in cancer
myd05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102774808 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102774808 (PTGS2)
   04064 NF-kappa B signaling pathway
    102774808 (PTGS2)
   04668 TNF signaling pathway
    102774808 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102774808 (PTGS2)
   04657 IL-17 signaling pathway
    102774808 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    102774808 (PTGS2)
   04913 Ovarian steroidogenesis
    102774808 (PTGS2)
   04921 Oxytocin signaling pathway
    102774808 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    102774808 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102774808 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    102774808 (PTGS2)
   05206 MicroRNAs in cancer
    102774808 (PTGS2)
   05204 Chemical carcinogenesis
    102774808 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    102774808 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    102774808 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102774808 (PTGS2)
   05165 Human papillomavirus infection
    102774808 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    102774808 (PTGS2)
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102774808 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102774808
NCBI-ProteinID: XP_006773002
UniProt: L5LBA3
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLVRALLLCAALALRAAANPCCSNPCQNRGVCMSVGFDQYTCDCTRTGFYGENCSTPEFM
TRIKLLLKPTPNTVHYILTHFKGVWDIVNNIPFLRNAIMKYVLTSRSDLIDSPPTYNAHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSDIILDKFMIRREFIPDPQGT
NLMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKLKY
QVIDGEVYPPTVKDTQAEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDSFHIDDQEYSYQQFLYNNSLLMDHGLTQFVESFSKQNAGRV
AGGRNLPVAVRKVAKASIEQSRHMRYQSLNEYRKRFRMKPYESFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEEPRPDSIFGETMVELGAPFSLKGLMGNPICSPHYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPSTSFSVGDPQPTKTVTINATPSHSGLEDINPTVLLKGR
SAEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtccgcgccctgctgctctgcgcagccctggctctccgcgctgcagcaaatcct
tgctgttccaacccatgccaaaaccgaggtgtatgtatgagtgttggatttgaccagtat
acgtgtgactgtactcgaacaggattctacggggaaaactgttcaacacctgaatttatg
acaagaataaaattactcctgaaacccactccaaacacggtgcactacatccttacccac
ttcaagggagtctgggacattgtcaataatattcccttcctgagaaatgcaattatgaaa
tatgtgttgacatccagatcagatttgattgacagcccaccaacgtataatgcacactac
ggctataaaagctgggaagccttttcgaatctctcctattataccagggctcttcctcct
gtggctgatgactgcccgactcccatgggtgtgaaagggaagaaagagcttcctgattca
gacattatcctggataaatttatgataagaagagagttcattcctgatccccagggcaca
aatttgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatcat
aagcgaggaccagctttcactaaaggactgggtcatggggtggatttaaatcatgtttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggatggaaaactgaaatat
caggtaattgatggagaggtatatcctcccacagtcaaagatacccaggctgagatgatc
tacccacctcatgtccctgaacacctgcggtttgccgtgggccaggaggtgtttggtctg
gtgcccggtctgatgatgtatgccacgatttggctgcgcgaacataacagagtgtgtgat
gtgcttaagcaggagcatccagaatgggatgatgagcggttgttccagacaagcaggcta
atactgataggagaaactattaagattgtgattgaagactatgtacaacacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccgcatcgctgctgagtttaacactctctaccactggcatccccttctgcccgactcc
tttcacattgatgaccaggagtacagctatcaacaatttctctacaacaattctttatta
atggaccatgggcttacccagtttgttgaatcattcagcaagcaaaatgctggcagggtg
gctggcggtcgaaatcttcccgttgcagtacgaaaagtagccaaggcctcaattgagcag
agcagacacatgagataccagtctctgaatgagtaccgcaaacgctttcggatgaagccc
tatgaatcattcgaagaacttacaggagagaaggaaatggctgcggagttagaagcgctc
tatggtgacattgacgccatggagctgtaccccgcccttctggtagaagagcctcgccca
gatagcatctttggtgagaccatggtagaacttggagcccccttttccttgaaaggactg
atgggcaatccgatatgttctcctcactactggaagcctagcacttttggtggtgaagtg
ggttttaaaatcatcaacactgcctccattcagtctctcatctgcaataacgtgaaaggc
tgcccctctacttcgttcagtgttggggacccacagcccaccaagacagtcaccatcaat
gcgaccccctcccactctggactggaggatatcaatcctaccgtactactaaaaggacgt
tcagctgaactgtag

DBGET integrated database retrieval system