KEGG   Myotis davidii: 102774956
Entry
102774956         CDS       T02992                                 

Definition
(RefSeq) cytochrome P450 4A6
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
myd  Myotis davidii
Pathway
myd00071  Fatty acid degradation
myd00590  Arachidonic acid metabolism
myd00830  Retinol metabolism
myd01100  Metabolic pathways
myd03320  PPAR signaling pathway
myd04270  Vascular smooth muscle contraction
myd04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:myd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102774956
   00590 Arachidonic acid metabolism
    102774956
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102774956
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102774956
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102774956
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102774956
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:myd00199]
    102774956
Enzymes [BR:myd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     102774956
Cytochrome P450 [BR:myd00199]
 Cytochrome P450, animal type
  CYP4 family
   102774956
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102774956
NCBI-ProteinID: XP_006762599
LinkDB
Position
Un
AA seq 455 aa
MGQELQQLQKWVEKFPCACPRWLWGSRVTIIIYDPDYMKVVLARSGSSTALSFLSDPKTY
GWYRFLAPWIGYGLLLVNGQTWLQHRRMLTPAFRYDILKPYIGLMADSVQVMLDKWEELI
SQDSHLEIFEHISLMTLDTIMKCAFSQQSSIQMDRKSQSQSYIQAIRDVKNLFYSRVRNF
FYQNDIIYWLTPDGLRSKRACQIAHQHTDQVIKLRKAHLQGEEDLEEVRRKRKLDFLDIL
LFARMKNESSLTDKDMRAEVDTFMFGGHDTTASGISWTLYALATHTEHQQRCRKEIQSLL
GDGASITWDHLDQMPYTTMCIKEALRLYPPVPNVGRELSKPITFPDGRSLPRGIHVSLNF
YALHHNPKVWPNPEVFDPSRFAPGSDSHSHAFLPFSGGSRNCIGKHFAMKELKVAVALTL
LRFELAADPRQAPIPLPKIVLDSKNGIHLKLRKLL
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgggccaggagctacaacagcttcagaaatgggtagagaaattcccatgtgcctgtcct
cgctggctatgggggagcagggtcaccatcatcatttatgaccctgactacatgaaggtg
gtcctggcaagatcaggttcctccactgccctgtctttcctttcagacccaaagacttat
ggctggtacagattcctggctccctggattggatatggtttgctcctggtgaatgggcag
acctggctccaacacaggcggatgctgaccccagccttccgctatgacatcctgaagccc
tacataggcctcatggctgactctgtccaagtgatgctggacaaatgggaggagctcatc
agtcaagactctcatctggagatctttgaacacatctctctgatgaccctggacaccatc
atgaagtgcgccttcagccagcagagcagcatccagatggacaggaaatcccaatcccaa
tcctacatccaggccattagggatgtgaaaaatcttttttattctcgagtgaggaatttc
ttctaccagaacgacattatctactggctgacgcctgatggcctccggagcaagcgggcc
tgccagatcgcccatcaacacacagaccaagtgatcaaactgagaaaggcacatctgcag
ggtgaggaagatctcgaggaggtccggagaaagaggaagttggatttcctggacatcctc
ctctttgccagaatgaagaatgaaagtagcttgactgacaaggacatgcgtgctgaagta
gatacattcatgttcgggggccatgacaccacagccagtggcatctcctggaccctctat
gctctggctacccacactgagcatcaacagaggtgccgcaaggagatccagagccttctg
ggggatggtgcctccatcacctgggatcacctggatcagatgccctacaccaccatgtgc
atcaaggaagcactgcgactctatccacctgtaccaaatgtcggcagagaactcagcaag
cccatcaccttccctgatggacgctccttacccagaggaatccatgtctcacttaacttt
tatgcacttcaccataatccgaaggtgtggcctaacccagaggtgtttgacccttcccgt
tttgcaccgggttctgattcacacagccatgctttcctgcccttctcaggaggatcaagg
aactgcattgggaagcattttgccatgaaggagctgaaggtggctgtggccttgaccctg
cttcgctttgagctggcggcagatcctcgccaagctcccatccccctcccaaagatcgtc
ttggattccaagaatgggatccacctgaagctcagaaagctcctctag

DBGET integrated database retrieval system