KEGG   Myotis davidii: 107181358Help
Entry
107181358         CDS       T02992                                 

Gene name
HTR1D
Definition
(RefSeq) 5-hydroxytryptamine receptor 1D
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
myd  Myotis davidii
Pathway
myd04024  cAMP signaling pathway
myd04080  Neuroactive ligand-receptor interaction
myd04726  Serotonergic synapse
myd04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107181358 (HTR1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107181358 (HTR1D)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    107181358 (HTR1D)
  09157 Sensory system
   04742 Taste transduction
    107181358 (HTR1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:myd04030]
    107181358 (HTR1D)
G protein-coupled receptors [BR:myd04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107181358 (HTR1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 107181358
NCBI-ProteinID: XP_006777640
LinkDB All DBs
Position
Un
AA seq 411 aa AA seqDB search
MHGPTSAKQDDCSVGETTVKAAAVCVGVYGEPPRMSPTNQSVEGLLQEASNRSLNATDTP
AAWDPATLQALQISLAVVLAIITLATVLSNAFVLTTIFLTRKLHTPANYLIGSLATTDLL
VSILVMPISIAYTITHTWTFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEY
SKRRTAGHAAAMIAIVWVISICISIPPLFWRQAKAQEEMLDCRVNTSQISYTIYSTCGAF
YIPSVLLIILYGRIYLAARNRILNPPSLYGKRFTTAQLITGSAGPSLCSLNPSLHEAHSH
LAGSALFFSQVKIKLADSVLERKRISAARERKATKTLGVILGAFIICWLPFFVASLVLPI
CRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEEFRQAFQKVVHFRKAS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcatggccccaccagtgcaaaacaggatgactgttctgtgggcgagacaactgtgaaa
gcagcagctgtgtgtgtcggagtctatggagagccacctagaatgtccccgacaaaccag
tcggtggaaggccttctgcaggaggcctccaaccggtctctgaatgctacggacactcca
gcagcctgggacccggcgaccctgcaggccctccagatttctcttgctgtggttcttgcc
atcatcacgctggccacagtcctttccaacgcctttgtgctcaccaccatcttcctcacc
aggaagctccacacccccgccaactatctcattggctcgctggccacgactgacctcttg
gtctccatcttggtcatgcccatcagcatcgcctataccatcacccacacctggaccttc
ggccaaatcctgtgtgacatctggctgtcttcggacatcacgtgctgcacggcctccatc
ctgcatctctgtgtcattgctctggacaggtactgggccatcacggacgccctggagtac
agtaaacgccggaccgcaggccatgccgcggccatgatcgccatcgtctgggtcatctcc
atctgcatctccatcccacctctcttctggcggcaggccaaagctcaggaggagatgttg
gactgccgggtgaacacttcccagatctcctacaccatctactccacgtgtggggccttc
tacatcccgtctgtgctgctcatcatcctctatggccggatctacctggctgcccggaac
cgcatcctgaacccaccatccctctacgggaagcgcttcaccacagcccagctcatcacg
ggctctgcggggccctccctctgctctctcaaccccagccttcacgaagcgcactcccat
ttggccggctctgctctctttttcagccaggtgaagatcaagcttgctgacagcgtgctg
gagcgcaagaggatctccgcggctcgggaaaggaaggccaccaaaaccctgggggtcatc
ctgggggcctttatcatctgctggctgcccttctttgtcgcatctcttgtcctccccatc
tgccgggactcctgctggatccacccagcccttttcgactttttcacctggctgggctat
ttaaactcgctcatcaatccagtcatctatactgtgtttaatgaagaattccggcaagca
tttcagaaagtggtccatttccggaaagcctcctag

DBGET integrated database retrieval system