KEGG   Mycobacterium sp. EPa45: AB431_06870Help
Entry
AB431_06870       CDS       T03960                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00473  D-Alanine metabolism
mye01100  Metabolic pathways
mye01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AB431_06870
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AB431_06870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mye01011]
    AB431_06870
Enzymes [BR:mye01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AB431_06870
Peptidoglycan biosynthesis and degradation proteins [BR:mye01011]
 Precursor biosynthesis
  Racemase
   AB431_06870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKK26459
UniProt: A0A0G3IHW8
LinkDB All DBs
Position
1457094..1458275
Genome map
AA seq 393 aa AA seqDB search
MHTTPLTSSTHTQVWRPGAEAIIDLGAIAHNVRVLREHAGSAQVMAVVKADAYGHGAVPA
GQAAVDAGAAELGVATIDEALALRRGGITAPVLAWLHPPGTDFAPALSADVGVAVSSVLQ
VGAVLDAVERTGRTAEVTVKVDTGLNRNGVSAADYPALLTELQRGVAADAVRLRGIMSHL
ANGDVPDDPLNDLQAQRFTDMIAEARSRGITFDVAHLSNSPSAMTRPDLGFDMVRPGIAV
YGLSPIPERGGMGLRPAMTLRCTVAMVKPVKAGDGVSYGHTWIAERDTNLALLPVGYADG
LYRTLGGRIDVLINGRLRRSVGRVCMDQFVVDLGPGDPDAAEGDEAILFGPGASGEPTAQ
DWADLLGTIHYEVVTSPRGRVVRTYREAAADGQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcacacgactccgttgacctcgtcgacgcacacccaggtttggcgccccggcgccgaa
gcgatcatcgatctcggggcgatcgcccacaacgtgcgtgttctgcgtgagcacgcaggc
tccgcccaggtgatggcggtcgtcaaagccgacgcctacggccacggcgccgtaccggcc
ggtcaggcggccgtcgacgccggcgcggccgagttgggtgtggccaccatcgacgaggcg
ctggcgctacgtcgcggcggcatcacggcaccggtcttggcctggttgcacccgccggga
accgacttcgccccggcgctgtcggccgacgtcggagtcgccgtgtcctcggtgcttcag
gtcggagcggtgctcgacgccgtcgaacgcacaggccgcacggctgaggtcactgtcaag
gtcgacaccgggctcaatcgcaacggggtcagcgccgcggactacccggccctgctgacc
gaactacagcgtggggttgccgccgacgcggtccggctgcgcggcatcatgtcgcacctg
gccaacggtgacgtccccgatgatccgctgaatgatcttcaggcacaacgatttaccgac
atgattgccgaagcccgctcacggggaatcaccttcgacgttgcgcacctgtccaactcg
ccgtcggcgatgacgcggccggatctgggcttcgacatggttcgtcccggtatcgcggtg
tacgggctgagcccgatcccggaacgcggtggtatgggattgcgcccggcgatgacgttg
agatgcaccgttgcgatggtcaaaccggtcaaagccggcgacggagtgtcctacgggcac
acctggatcgccgagcgggacaccaacctggcgctgctgccggtgggttacgccgacggg
ctgtatcgcacactcggcggccgcatcgacgtcctgatcaacggtcggttgcgtcgcagc
gtcggccgggtgtgcatggaccagttcgtcgtcgatctcggccccggcgaccccgacgcc
gccgagggcgacgaggcaatcctgttcggccccggcgcgtccggcgaaccgaccgctcaa
gattgggccgacctgctcggcacgatccactacgaggtagtcaccagcccgcgcggacgg
gtcgtgcgcacctaccgggaggccgccgccgatgggcagtga

DBGET integrated database retrieval system