KEGG   Mycobacterium sp. EPa45: AB431_07480Help
Entry
AB431_07480       CDS       T03960                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00564  Glycerophospholipid metabolism
mye01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AB431_07480
Enzymes [BR:mye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AB431_07480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 NAD_binding_8 GIDA 3HCDH_N HI0933_like Pyr_redox Thi4 AlaDh_PNT_C Hairy_orange
Motif
Other DBs
NCBI-ProteinID: AKK26560
UniProt: A0A0G3IGF1
LinkDB All DBs
Position
1592817..1594562
Genome map
AA seq 581 aa AA seqDB search
MSDPILRPGTGQTLLGPSERSQAWERLGSEQFDVVVIGGGVVGAGCALDAATRGLKVALV
EARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERELSLTALAPHLVKPLPFLFPL
TKRVWERPYIAAGIFLYDQLGGSKSVPAQKHLTKSGALRLAPGLKRSSLIGGIRYYDTVV
DDARHTMTVARTAAHYGAVVRTSTQVVSLLREGDRVIGVKIRDSEDGSVEDVRGHVVINA
TGVWTDEIQALSKERGRFRVRASKGVHVVVPRDRVVSEVAIILRTEKSVLFVIPWGTHWI
IGTTDTDWNLDLAHPAATKADIDYILGTVNKVLATPLTHDDIDGVYAGLRPLLAGESEET
SKLSREHAVAVPSPGLVAIAGGKYTTYRVMAEDAVDAAAEYIPARVAPSITEKVPLMGAD
GYFALVNQTQSVGARYGLHPYRVRHLLDRYGSLIGDVLSLAVGRPELLEPITDAPVYLKV
EAAYAAAAEGALHLEDILARRMRISIEYPHRGVDCALQVAEIVAPILGWSEADCAREVAT
YLARVEAEILSQTQPDDASADALRASAPEARAEILEPVPLN
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacccgatccttcgaccgggcaccggtcagacccttctcggaccttccgaacgg
tcgcaagcctgggagcggttgggcagcgaacagttcgacgtcgtcgtcatcggcggtggc
gtggtcggtgccggctgcgcactggatgccgcgacccgtgggctcaaggtggccctcgtg
gaagcgcgggacttcgcgtcggggacatcgagccgcagttcgaagatgttccacggcgga
ctgcgctatctcgagcagttggagttcggcctggtgcgtgaggcactgcacgagcgcgag
ctatcactgaccgcgctggcgccgcatctggtcaagccgcttccgttcctgttcccgctg
accaaacgggtgtgggagcggccgtacatcgccgcgggcatcttcctctacgaccagctg
ggcggctcgaaatccgttccggcgcaaaaacatctgaccaagtcgggtgcgctgcggctg
gcgcccgggctcaagcgcagctcgctgatcggcggcatccgctattacgacaccgtcgtc
gacgacgcgcggcacaccatgaccgtggcgcgcaccgccgcccactacggcgcggtggtg
cgcacctcgacgcaggtggtctcgctgctgcgggagggcgaccgggtgatcggggtcaag
atccgggactccgaggatgggtcggtcgaggacgtccgcggccacgtcgtgatcaacgcg
accggggtgtggaccgacgagatccaggccttgagcaaggagcgcggacggttccgggtg
cgcgcgtccaagggtgtgcacgtcgtggtgccccgcgaccgcgtcgtgtccgaggtggcg
atcatcctgcgcaccgagaagtcggtgctgttcgtgatcccgtgggggacgcactggatc
atcgggaccaccgataccgactggaacctcgacctggcgcatcctgccgcgacgaaggcg
gacatcgactacatcctcggcaccgtcaacaaggtgctggccacgccgctcacgcacgac
gacatcgacggtgtgtacgccgggctgcggccgctgctggcgggggagagcgaagagact
tccaagctgtcccgcgagcatgccgtcgcggtgccgtcgccgggcctggtcgcgatcgcg
ggcggcaagtacaccacctaccgggtgatggccgaggacgcggtcgacgccgccgccgag
tacatcccggcgcgggtggcgccctcgatcaccgagaaggtgccgttgatgggcgccgac
gggtactttgcgctggtcaaccagacccaaagcgtgggcgcccgctacggcctgcacccg
tatcgggtgcggcatctgctggatcggtacggttcgctgatcggcgacgtgttgtcgttg
gccgtcggcaggccggagctgctcgagccgatcaccgatgcgccggtgtacctcaaggtg
gaggcggcctacgccgcagccgcggagggggcgctgcacctcgaggacatcctggcccgg
cggatgcggatctcgatcgaatacccgcaccgcggcgtggactgtgccctccaggtggcc
gagatcgtagccccgatcctcggctggagcgaagctgactgtgcccgtgaggtggccacg
tatctggcccgggtggaggccgaaattctgtcgcagacccagccggacgacgcctcggcc
gatgcgctgcgggcgtctgcgccggaggcgcgtgccgagatcctcgagcccgtgccactg
aactga

DBGET integrated database retrieval system