KEGG   Mycobacterium sp. EPa45: AB431_12685Help
Entry
AB431_12685       CDS       T03960                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00250  Alanine, aspartate and glutamate metabolism
mye00280  Valine, leucine and isoleucine degradation
mye00310  Lysine degradation
mye00410  beta-Alanine metabolism
mye00640  Propanoate metabolism
mye00650  Butanoate metabolism
mye01100  Metabolic pathways
mye01120  Microbial metabolism in diverse environments
Module
mye_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AB431_12685
   00650 Butanoate metabolism
    AB431_12685
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AB431_12685
   00280 Valine, leucine and isoleucine degradation
    AB431_12685
   00310 Lysine degradation
    AB431_12685
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AB431_12685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mye01007]
    AB431_12685
Enzymes [BR:mye01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AB431_12685
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AB431_12685
    2.6.1.48  5-aminovalerate transaminase
     AB431_12685
Amino acid related enzymes [BR:mye01007]
 Aminotransferase (transaminase)
  Class III
   AB431_12685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKK27385
UniProt: A0A0G3IIK9
LinkDB All DBs
Position
complement(2666642..2667982)
Genome map
AA seq 446 aa AA seqDB search
MTTLEQSRKLVTEIPGPGSVELSKRRVAAVSHGVGVTMPVYTARAGGGIIEDVDGNRLID
LGSGIAVTTIGNASPRVVEAVQAQVADFTHTCFMVTPYEEYIAVAEHLNRLTPGSYEKRS
ALFNSGSEAVENAIKIARSYTRKTAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPFRDGLIDKEWATDGELAAERALNIIDKQIGAANLAAVIIEPIQGEGGFIVP
APGFLPALRAWCSDNNVVFIADEVQTGFARTGTMFACEDEGIEPDLIVTAKGIADGLPLS
AVTGRAEIMDAPHVSGLGGTYGGNPLACAAALATIETIELDGLVDRAKQIEALMKDKLGR
MQADDDRIGDVRGRGAMIAVELVKSGTAEPDPELAKTLAARAHAQGVVVLTCGTYGNVLR
FLPPLAISDELLVEGLDVLAEILAAL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactctcgagcagagccgcaaactcgtcaccgagatcccgggccccgggtccgtc
gaactgagcaagcgcagggtcgcggcggtgtcgcacggcgtcggtgtcacgatgcccgtc
tacacggcgcgggcaggcggcgggatcattgaggacgtcgacggtaaccggctgatcgac
ctgggctcgggcatcgcggtgacgacgatcggtaacgcctcaccacgcgtggtcgaggcg
gtgcaggcccaagtcgccgacttcacccacacgtgcttcatggtgacgccctacgaggag
tacatcgccgtcgcggagcacctcaaccggctcaccccggggtcctacgagaagcgctcg
gcactgttcaattccgggtccgaagcggtggagaacgcgatcaagatcgcccgctcgtat
acccgcaagaccgcggtggtggccttcgaccacgcctaccatgggcgcaccaacctgacg
atggcgctgaccgccaagtcgatgccctacaagagcgggttcggaccgttcgccccggag
atctaccgcgcccccctctcctatcccttccgcgacggcctgatcgacaaggagtgggcc
accgacggcgagctggccgccgagcgggcgctgaacatcatcgacaagcagatcggcgcg
gccaacctcgccgcggtgatcatcgagccgatccagggcgagggtgggttcatcgttccc
gcgccgggcttcctgcctgcgctgcgggcctggtgttcggacaacaacgtggtgttcatc
gccgacgaggtgcagaccggattcgcccgcaccggaacgatgttcgcgtgcgaggacgag
ggcatcgagccggacctgatcgtgacggccaagggcatcgccgacggtctgccgctgtcg
gcggtgaccgggcgcgccgagatcatggacgctccgcatgtcagcggtctcggcggcacc
tatggcggcaatccgttggcgtgtgcggccgcgctggcgaccatcgagaccatcgagctc
gacgggctggtggatcgggccaagcagatcgaagcgctgatgaaagacaagctcggtcgg
atgcaggccgacgacgaccgcatcggtgatgtgcgcggccgcggtgcgatgatcgccgtc
gagttggtgaaatcgggtaccgcagaaccggatccggagctggccaagacactggcggcc
agggcgcacgcccagggtgtggtggtgttgacgtgtggcacctacggaaacgtgctgcgg
ttcctgccgccgctggccatcagcgacgagctcttggtcgagggcctcgacgtgctggcc
gagattctcgccgcactctga

DBGET integrated database retrieval system