KEGG   Mycobacterium sp. EPa45: AB431_24205Help
Entry
AB431_24205       CDS       T03960                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mye00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AB431_24205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mye03400]
    AB431_24205
Enzymes [BR:mye01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AB431_24205
DNA repair and recombination proteins [BR:mye03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AB431_24205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AKK30826
UniProt: A0A0G3IZZ9
LinkDB All DBs
Position
complement(5134262..5136550)
Genome map
AA seq 762 aa AA seqDB search
MVNEVWPPGATRGPRVTLTNADKVLYPATGTTKADVFSYYTTIADVMLPHIAGRAVTRKR
WPNGVDEPSFFEKQLASSAPGWLERATVDHRSGSTTYPIIETATGLAWIAQQASLEVHVP
QWRFTPDGKTGPATRLVFDLDPGEGVTMPQLCEVANAVRELMDDIGLTVYPLTSGSKGLH
LYAPLADPVSSNGAVVVARRVAQQLEKSMPKLVTATMTKSLRDGKVFLDWSQNSGSKTTI
APYSLRGRETPTVAAPRTWDEIGDPELRHLEYHEVLARVAEQGDLLAALDDDVPRHDRLT
TYRSMRDAAKTPEPVPAAKPAVGENNTFVIQEHHARRLHYDFRLERDGVLVSWAVPKNLP
ATPAVNHLAVHTEDHPLEYATFEGQIPKGEYGGGKVIIWDAGTYEAEKFRDSGDKGGEVI
VDLHGQRISGRYALIQTNGDQWLAHRMKEQPTPRLQDYSPMLATLGSVEKLTGAQYAFEG
KFDGYRLLVEISGGQLRAQSRSGRDLTADYPQLRSLAADLADHDVILDGEVVALDADGVP
NFGEMQNRVRATRIEFWAFDILRLDGRSLLKAKYRDRRKVLETFAEGTDLIVPPLLDGDG
PEALEFSRKKKWEGVVAKKWDSTYQPGRRSAAWIKDKNWNTQEAVIGGWREGNGGRSSGI
GALLLGIPGDGGLRFVGRVGTGFSDKELTKLKKILEPLHTDESPFATPLPRVDAKGVTYV
RPELVGEVRFGEWTSDGRLRHPSWRGLRPDKVPADVKLESPS
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatgaggtgtggccgccgggggcgacgaggggaccgcgtgtcacgctgaccaac
gccgacaaggtgctctacccggccaccggcaccacgaaggccgacgtgttctcctactac
acgaccatcgccgacgtgatgctgccgcacatcgcgggcagggcggtcacccgcaaacgg
tggcccaacggcgtcgatgagccgtcgttcttcgagaagcagctggccagctcggcgccc
gggtggctggagcgtgcaacggtggatcatcgctcgggcagcaccacctatccgatcatc
gagacggcgaccgggctggcatggatcgcgcagcaggcgtcgctggaagtccatgtgccg
caatggcgtttcaccccagacggaaagaccggccctgcaacgcgtttggtgttcgacctc
gacccgggtgaaggggtcacgatgccgcagctgtgcgaggtggccaacgcggtccgcgag
ctgatggacgatatcgggctgacggtctacccactcaccagtggcagcaagggtctgcat
ctctatgcaccgctggccgatccggtcagcagcaacggtgcggtcgtggtcgcccgccga
gtggcccagcagctggagaaaagcatgcccaagctcgtcacggccacgatgaccaaaagc
ctgcgggacggcaaggtcttcctggactggagccagaacagcggctccaagacgacgatc
gcgccgtattccctgcggggccgggagaccccgacggtcgccgcgccccggacgtgggac
gagatcggtgatcccgagctgcggcacctggagtaccacgaggtgctggcgcgggtcgcc
gagcagggcgatctgctggccgccctggacgacgacgtaccgcggcacgaccggctgacg
acatatcgcagcatgcgggatgcggcaaagacacccgagccggtgccggcggccaagccc
gccgtaggggagaacaacacgttcgtcatccaggaacaccatgcgcgacggctgcactac
gacttccggctggagcgtgatggcgtgctggtgtcgtgggcggtgcccaagaatctgccg
gcgaccccggcggtgaaccatctggccgtgcacaccgaggatcacccgctggagtatgcg
acgttcgaggggcagatcccgaagggcgagtacggcgggggcaaggtgatcatctgggat
gccggaacctatgaggccgagaagttccgggactccggcgacaagggcggcgaggtcatc
gtcgatctgcacggccagcgaatctcgggccgctacgcgctgattcagaccaatggcgac
cagtggcttgcgcaccggatgaaggagcagccgacaccacggttacaggattattcgccg
atgctcgcgacgttggggtcggtcgagaagctgaccggggcgcagtacgcgttcgagggg
aagttcgacggctaccggctactggtcgaaatctcgggcggacagctgcgggcgcagtcc
cgcagcgggcgcgacctgactgccgactatccgcaattacgctctctggcggccgatctc
gctgaccatgacgtcatcctcgacggcgaggtggtggccctcgatgcggacggcgtgccg
aacttcggtgagatgcagaaccgggtgcgcgccaccaggatcgagttctgggcgttcgac
atcctgcggctcgacgggcgctcactactgaaggcgaaataccgcgaccgacggaaggtg
ctcgaaaccttcgccgagggaacagatctgatcgtgccgccgctactcgacggcgacggt
ccggaggcgctcgagttctcccgcaagaagaagtgggagggcgtcgtcgccaagaagtgg
gactcgacgtatcagccgggtcggcgatcagcggcgtggatcaaggacaagaactggaat
acccaggaggccgtgatcggcgggtggcgtgagggcaatggcgggcggtccagcggtatc
ggtgcgttgttgctcggcattcccggcgatggtggcctgcggttcgtcggccgggtgggg
accggtttctcggataaggaactgacgaagctcaagaagatcctggagccgttgcacacc
gacgaatcgccctttgccacaccgcttcccagggtcgacgcgaagggcgtcacctatgtg
cggccggagctggtcggcgaggtgcgcttcggtgagtggacgtccgacggccgtctgcgc
cacccgagctggcgcggcctgcggcccgacaaggtgcccgccgacgtgaaactggagtcg
ccgagttag

DBGET integrated database retrieval system