KEGG   Mycobacterium sp. EPa45: AB431_24745Help
Entry
AB431_24745       CDS       T03960                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00010  Glycolysis / Gluconeogenesis
mye00071  Fatty acid degradation
mye00350  Tyrosine metabolism
mye00625  Chloroalkane and chloroalkene degradation
mye00626  Naphthalene degradation
mye01100  Metabolic pathways
mye01110  Biosynthesis of secondary metabolites
mye01120  Microbial metabolism in diverse environments
mye01130  Biosynthesis of antibiotics
mye01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB431_24745
  Lipid metabolism
   00071 Fatty acid degradation
    AB431_24745
  Amino acid metabolism
   00350 Tyrosine metabolism
    AB431_24745
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AB431_24745
   00626 Naphthalene degradation
    AB431_24745
Enzymes [BR:mye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AB431_24745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C HutP 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AKK29345
UniProt: A0A0G3IP22
LinkDB All DBs
Position
complement(5239164..5240225)
Genome map
AA seq 353 aa AA seqDB search
MTQTLDTSNTSPTTGTMRAAVVTEFGAPLQIAELDLPTPGPGEALVKLETSGVCHTDLHA
AHGDWPVKPQPPFIPGHEGYGTVVALGDGVTDLKVGDKVGNAWLWSACGSCEYCRTGWET
LCESQQNGGYSVNGSFGTYMLVNAAYAARIPDGVDPLEVAPILCAGVTVYKGLKVTDTRP
GQWVAISGIGGLGHIAVQYARAIGLRVVAVDVDDAKLALASSLGAEVTVNAKTSDVVEEV
QKATGGVHGVLVTAVHPQAFGQAIGLARRGGTIVFNGLPPGDFPAPIFDIVLKGLTIRGS
IVGTRQDMTEALDFYARGLIHPTVQAATLDEVNEVFGRMERGQIDGRVVIDYR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactcagacactcgacacctcgaacacctcgcccaccaccggcaccatgcgggccgcc
gtcgtcaccgaattcggcgcgcccctgcagatcgccgagctcgacctgccgaccccgggt
cccggtgaggccttggtcaagctggagacctccggggtctgccataccgatctacacgcc
gcccatggtgactggcccgtcaagccgcaaccaccgttcatcccgggccacgagggttac
ggcaccgtcgtcgccctcggcgatggcgtcaccgacctcaaggtcggcgacaaggtcggc
aatgcgtggctgtggtcggcgtgcggcagctgcgaatactgccgcaccggctgggaaacg
ctctgcgagagccaacagaacggtggctacagcgtcaacggcagcttcggcacctacatg
ctggtcaatgccgcgtacgccgcgcggattccggacggcgtcgacccactcgaggtcgcg
ccgatcttgtgcgccggcgtcacggtgtacaagggactgaaggtcaccgatacccgtccg
ggacagtgggtggcgatctccggcatcggcggcctcgggcacatcgcggtgcagtatgcc
cgcgcgataggtctgcgggtggtggccgtcgacgtcgatgacgccaaactcgcgctggcg
tcgagcctcggcgcggaagtcaccgtgaatgccaagacctccgacgtcgtagaggaggtg
cagaaggccaccggtggtgtgcacggggtgctcgtcaccgcggtgcatccgcaggcgttc
ggccaagcgatcggcctggcccgccgcggtggaacaatcgtgttcaatggccttccgcca
ggcgactttcccgccccgatcttcgatatcgtgttgaaggggttgacaattcgcggttcg
atcgtcggcacgcgccaggacatgaccgaggccctggacttctatgcccgtggcctgatc
caccccacggtccaagctgccaccctggacgaggtcaacgaggtgttcggccggatggaa
cgcggccaaatcgacggccgggtcgtcatcgactaccgctga

DBGET integrated database retrieval system