KEGG   Mycobacterium sp. EPa45: AB431_27425Help
Entry
AB431_27425       CDS       T03960                                 

Definition
(GenBank) glutamate synthase
  KO
K22083  methylamine---glutamate N-methyltransferase subunit C [EC:2.1.1.21]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00680  Methane metabolism
mye01100  Metabolic pathways
mye01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    AB431_27425
Enzymes [BR:mye01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.21  methylamine---glutamate N-methyltransferase
     AB431_27425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_synthase FMN_dh NMO IMPDH His_biosynth DHO_dh ThiG QRPTase_C Glu_syn_central NanE LrgB PcrB
Motif
Other DBs
NCBI-ProteinID: AKK29795
UniProt: A0A0G3IQ78
LinkDB All DBs
Position
5765149..5766483
Genome map
AA seq 444 aa AA seqDB search
MTYAEDDRARLGLRESATFDRATIAAIQRAADTGIYDIRGWGAKRALPHFDDLLFLGASM
SRYPLEGYRERCGTDVVLGDRHAKHPLHLEIPVTIAGMSFGALSGPAKEALGRGASEVGT
STTTGDGGMTPEERGQSKYLVYQYLPSRYGMNPDDLRKADAIEVVLGQGAKPGGGGMLLG
QKISERVAAMRTLPEGIDQRSACRHPDWTGPDDLTIKINELRELTDWEKPIYVKVGATRT
YYDVKLAVAAGADVVVVDGMQGGTAATQDVFIEHVGIPTLAAVPQAVQALSELGVHRTVQ
LIVSGGIRTGADVAKAMALGADAVAIGTAALIALGDNDPKYAAEYEKLGSAAGFYDDFQD
GRDPAGISTQDPELAARLDPVEGGRRLANYLRVLTMEAQTIARACGKAHLLHLEPEDLVA
VTIEAAAMARVPLAGTSWIPGAGL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgcagaagacgaccgcgcccgcctcggcctgcgcgagtcagccaccttcgac
cgcgccaccatcgcggcgatccaacgcgccgccgataccggcatctacgacatccggggc
tggggtgccaagcgcgcgctgccccacttcgacgacctgctgttcctcggcgcgtcgatg
tcgcggtacccgttggagggctatcgcgagcggtgtggcaccgacgtcgtgctcggcgat
cggcatgccaaacaccctctgcacctggagatcccggtcacgatcgccggcatgtccttc
ggcgcgctgtccgggcctgccaaagaggcgctgggtcgcggcgccagcgaggtcggcacg
tcgaccaccaccggcgacggcgggatgacgcccgaggagcggggacagtcgaagtatctg
gtctatcagtaccttccatcgcgttacgggatgaacccggacgatctgcgcaaggcagac
gccatcgaggtcgtcctcggtcagggcgccaagcccggtggcggcggaatgctgctgggg
cagaagatctccgaacgggtggccgcgatgcgcacgctgcccgaggggatcgaccagcgg
tccgcctgccggcatccggattggaccgggcccgacgacctgaccatcaagatcaacgag
cttcgcgagctcaccgactgggagaaaccgatctacgtcaaggtcggcgccacccgcacc
tactacgacgtgaagctggcggtcgcggcgggggccgacgttgtcgtggtcgacggtatg
cagggcggcaccgctgcgacccaggacgtcttcatcgagcatgtcggcattcccacgctg
gccgccgttcctcaagcggtccaggcactctccgagctgggcgtgcatcggacagtgcaa
ctcatcgtgtcgggcggcatccgcaccggcgctgatgtcgccaaggcgatggccctgggt
gccgacgcggtggcgatcggtaccgcggcgctgatcgcgctgggtgacaacgacccgaag
tacgccgccgagtacgaaaagctcggcagcgcagccggtttctacgacgacttccaagac
ggccgagacccggccggcatcagcacacaggacccggagctcgccgcccgcctcgacccg
gtcgagggcggccgccgcctggccaactacctgcgggtgctcaccatggaggcccagacc
atcgcgcgcgcgtgcggcaaggcccacctgttgcacctggagcccgaggacctcgttgcg
gtcaccatcgaggccgcggcgatggcacgggtgccgctggcgggtacgtcgtggattccc
ggagccggactgtga

DBGET integrated database retrieval system