KEGG   Mycobacterium sp. EPa45: AB431_27590Help
Entry
AB431_27590       CDS       T03960                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mye  Mycobacterium sp. EPa45
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AKK29824
UniProt: A0A0G3ISK4
LinkDB All DBs
Position
5798300..5799364
Genome map
AA seq 354 aa AA seqDB search
MQLPVNPPVSPMLAKAARTIPPDASYEPKWDGFRSVCFRDRDDVVLGSRNEKPLTRYFPE
LVSAALAELPERCVIDGEIVIATGEGLDFEALQQRVHPADSRVRMLAAKTPAAFVAFDLL
ALGDEDFTGRPFSERRAALVEALADVGPSFHVTPATTDPATAQRWFSEFEGAGLDGVIAK
PLTITYQPDKRVMFKIKHERTADCVVAGYRVHKSSDDAIGSLLLGLYNDDGVLAPVGVIG
AFPMAERRRLFNELQSLVTQFENHPWNWAALESGERTPQKNAGSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGERFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFSLSDIVPGLG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgcccgtcaatcccccggtgtcgccgatgctcgcaaaggcagcgcggaccatc
ccgcccgacgcgtcctacgagccgaagtgggacggttttcggtcggtgtgcttccgagac
cgtgacgacgtcgtgctgggaagccgcaatgagaagccgctgacccgatacttcccggag
ttggtcagcgccgctcttgccgagttgccggagcgctgcgtgatcgacggtgagatcgtc
atcgccaccggtgagggcttggatttcgaggcgctgcagcaacgggtccaccccgcggac
tcgagagtccggatgctcgccgcgaagacgcccgcagcattcgtcgcgttcgatctgctc
gcgttgggagacgaggatttcaccggccggccgttcagcgagcggcgcgccgcgctggtg
gaggcgttggcagacgtcgggccgtcgtttcacgtcacccccgccacgaccgatccggcg
accgcgcagcggtggttctccgaattcgagggagccgggctggacggagtgatcgcaaag
ccgctgacgatcacctaccaacccgacaaacgggtgatgttcaaaatcaagcacgagcgg
acggctgactgtgtggttgccggttaccgagtgcacaagtcgagcgacgacgccatcggg
tcgttgctgctcggcctctacaacgacgacggggtgctggcgccggtgggcgtcatcggc
gcattcccgatggccgagcggcgacgcctattcaacgaactgcagtccctggtaacgcaa
ttcgagaatcatccatggaactgggcagcactcgagtcgggcgaacgcacaccacagaag
aatgccgggtcgcgatggaacgccggcaaagatctctcattcgttccgctgcggcccgag
cgcgtggtcgaggtgcgctacgaccacatggagggtgagcggttccggcacaccgctcaa
ttcaaccgctggcggcccgatcgcgacccgcgctcgtgcacctacgagcagctcgagcaa
ccagtgaccttcagcctcagcgacatcgtgcccgggctcggttag

DBGET integrated database retrieval system