KEGG   Mycoplasma sp. (ex Biomphalaria glabrata): ASO20_00725Help
Entry
ASO20_00725       CDS       T04239                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
myg  Mycoplasma sp. (ex Biomphalaria glabrata)
Brite
KEGG Orthology (KO) [BR:myg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myg01001]
    ASO20_00725
Enzymes [BR:myg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ASO20_00725
Protein kinases [BR:myg01001]
 Serine/threonine kinases: Other
  Bacterial family
   ASO20_00725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase RIO1 Pkinase_fungal Kdo Kinase-like APH COX_ARM
Motif
Other DBs
NCBI-ProteinID: ALV23200
UniProt: A0A0U3PSI3
LinkDB All DBs
Position
complement(204724..205752)
Genome map
AA seq 342 aa AA seqDB search
MTNLIKGRYEIVDTIGEGGMATILLAKDVIYGRHVALKRLKIEDIKTIETNLIRFKNEAQ
IISAVSSSSNNLVHIYDYFSEGLYEYIVMEFVDGENLKQVLRERSHFHYYEACQILYEIA
KGLKAIHNCNIVHRDLKPENILIKSDGTIKIADFGISILEGANHSLTKANVIIGSVQYMA
PEAITDKDSISKATDIYALGVILYEMITGSNPFVRANMYDILRDQIKRKIPSVNTRFPNI
PNKIDFFIQKCTAKNLNNRYKNIDDVINDLEIILDKKENNLIAEVKDKHEVNNIPLKWRR
KLSRKSEAAMPFLGTKRVISLMMILLVALFAGIIIVLILGKK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaatctaatcaaaggaagatatgaaatagtagataccattggtgaaggcgggatg
gccactattttattagcaaaagacgttatttatgggcgtcatgttgccttaaaacgtttg
aaaatcgaggacattaaaacaattgaaacaaatttaattcgttttaaaaatgaagcgcaa
attattagtgcagtttcatcaagttcgaataatttggttcatatatatgattatttttcc
gagggattatatgaatatattgttatggaatttgttgatggagaaaatttaaaacaagtt
cttagggaaagatcgcactttcattattatgaggcttgccaaattctatatgaaatagcg
aaaggtctaaaggctattcataattgcaatattgtacatcgcgatttaaaaccagaaaat
attttaattaaatcagatggaacaattaaaattgcagattttggtatttcgattttagaa
ggggcaaatcattctttaactaaagcgaatgttattataggtagcgtacaatatatggct
cctgaggcaatcactgacaaagatagtatttctaaagctactgacatatatgcattaggt
gtgattctatatgagatgattacaggttcaaatccgttcgttagagctaatatgtatgat
atcttacgtgaccaaattaaaagaaaaattccgtcagttaacacacgattcccaaatatt
cctaataagattgatttttttatccaaaaatgtactgcaaaaaatttgaataatcgatat
aaaaatattgatgatgtaattaatgatttagaaataattctcgataaaaaggaaaataat
ttaatagcagaagtaaaagataaacacgaagtaaataacattccactaaagtgaaggaga
aaactttctcgtaaatctgaagcagctatgccgtttttaggaacaaaaagagttatttct
ttaatgatgattttattagttgcactttttgccggaattattattgtattaattttggga
aagaaataa

DBGET integrated database retrieval system