KEGG   Mizuhopecten yessoensis (Yesso scallop): 110444824Help
Entry
110444824         CDS       T05079                                 

Definition
(RefSeq) tyrosine-protein kinase ABL1-like
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myi01001]
    110444824
Enzymes [BR:myi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110444824
Protein kinases [BR:myi01001]
 Non-receptor tyrosine kinases
  ABL family
   110444824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SH3_3 SH3_1 SH3_9 SH3_2 Pkinase Pkinase_Tyr SH3_4 GW
Motif
Other DBs
NCBI-GeneID: 110444824
NCBI-ProteinID: XP_021344854
LinkDB All DBs
Position
Unknown
AA seq 203 aa AA seqDB search
VITAGEQVTILGYNKGGEWCEVKNKAGDIGWVPSNYIAPVNSLDKFSWYHGQISRNASEY
LLSSGINGSFLVRESESSPGQRSISVRFEGRVYHYRISEDSDGKVFVTQEHRFNTLAELV
HHHSIHSDGLVTTLLYPAPKRTKPTVFGLSPEPDRWEIERTEIAMKHRLGGGQYGDVYEA
IWKRYNKTVAVKTLKVRNTHWLN
NT seq 614 nt NT seq  +upstreamnt  +downstreamnt
atgtcataactgcaggtgaacaggtgaccatcctgggctataacaagggaggcgagtggt
gcgaggtcaaaaacaaggccggggacatcggctgggtgcctagcaactacatcgcaccgg
tcaacagccttgataagttttcctggtaccatggacagatttctcggaacgcatcggagt
acctgctcagtagtggcatcaatggaagcttcctggtccgggagagtgagagcagcccgg
gtcaaaggtcgatatcagtcaggtttgagggaagggtctaccattacaggatcagcgagg
attccgatggaaaggtgtttgtgactcaggagcaccgctttaacacgctggcagaacttg
tccaccaccactccatacactcagatggcctggtcaccacgctgctataccctgccccaa
aacgcaccaaaccaacagtgttcggccttagccccgagcctgaccgatgggagatcgaac
gcacggaaattgccatgaaacacaggctaggcggaggtcagtatggcgatgtatatgagg
caatttggaagcgctacaacaaaactgttgctgttaaaactctcaaggtaagaaatacac
actggttgaattaa

DBGET integrated database retrieval system