KEGG   Mizuhopecten yessoensis (Yesso scallop): 110445164Help
Entry
110445164         CDS       T05079                                 

Definition
(RefSeq) DNA ligase 4-like
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:myi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    110445164
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:myi03400]
    110445164
Enzymes [BR:myi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110445164
DNA repair and recombination proteins [BR:myi03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     110445164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C BRCT_2 BRCT DNA_ligase_IV RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 110445164
NCBI-ProteinID: XP_021345286
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MADANDDDKPSVTVASKVSFAELCGLLEKISKTQGNDKKKRILTEFVDKWRDFHNSLHKD
DKKDTTDSFYPAMRLLLPHHEKERVAYGIKEHMLAKLLIEVLCLGKDSADANRLLNYKAP
KTARADAGDFAGVTYFVLKNRCPEKGTLTIQEVNDCLDGIAQNNAAKKKDLVRKNVLRLL
TNMTAVELKWLIRMIVKELKVGLSQASVLSVYHPDAEDFFNVNNNLEKVCRMLRERSVRV
HEIGISIFSPFSPMLGERASPDEVEKLMEGKTYFLETKFDGERMLLHKRDNEYKYFSRSA
NEYTATFGSNSFDGNFTQYIHDLFKPGIKSCILDGEMLGYHAETKTYATKAMNTDIKRQQ
QEGYQPCYNIFDIVVLNDKVLTNKPLRERLQLLETVIDPEEGRIQISKHTEANTNQECAD
ALNKAIDGREEGIMVKNPDSVYRPNTRKGGWIKIKPEYVGGLMDELDVVVVGGYLGVGHR
GGMMSHFLCAVAVPVDDGEKPEVFHSFCKVGSGYSKKELGEVNEKLKDHWKAFDKRNPPT
SIILASGFKEKPDAWIEPSNSVIVQIKAAEIIDSDRFKTNCTLRFPRVECFRDDKAWHDC
MTVTDILELKEKSGGKLAGGKVELAEGEEPVKKKRKIVSRVVRPTLGAQFMGADLTSVTQ
VSKMLEGKEFCVINGPSSFPKHAIETKIVEFGGKIVQNPGPSTFCVLADKVAVRVTNLIK
RDMYDVVKVSWFQRCVDASRWLPWSPADMIHTSPKTQLDFQKQYDEFGDSYVDPTSPEQL
KTVFSRISKVENGMTDALDIAEIEQAYFPDDSPYGMFRTCRFYMDDSLVIDDKSTKSKNS
FLDFLALELRFFGGAIAEEIDPAVSHVMMDNSDLSRLEEIKEMRRQRRKKFHIVTRFWVR
ECMQEGTLVSERRFEPS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgctaacgacgatgacaaaccatccgtaactgtcgcatccaaagtatcattt
gcagaactctgtggactgcttgagaaaatatccaaaacacaaggaaatgacaaaaagaaa
cgaattttaacagaatttgttgataaatggagagattttcataactcactacacaaagac
gataaaaaagacacgactgattccttttatcctgccatgcgattgttacttcctcaccat
gagaaggagagagtggcatacggaataaaagagcatatgttggccaaactactgatcgag
gtgttgtgtttagggaaggatagtgctgatgccaacaggctgcttaactacaaagctccg
aaaacagccagagcggacgctggagattttgcgggtgtgacctactttgtgttgaagaac
cgctgtccagagaagggaacactgaccattcaggaggtcaatgactgtctggacggcatc
gctcagaacaatgcggccaagaagaaggatttggtgaggaagaatgttctgcggctgttg
actaacatgacagcagtggagctcaagtggctcatcaggatgattgtgaaggaactgaag
gtggggctgagtcaggcatctgtcttatcagtgtatcatccggacgctgaggacttcttc
aacgtcaacaataacctggaaaaggtgtgtcggatgctgagggagcggagtgttcgggta
catgagatcggtatcagcatcttctcacccttctcgccgatgctgggggagagagcctca
cctgatgaggtggagaaactgatggaggggaaaacctacttcctagagacaaagtttgat
ggagaacgcatgctgttacataaacgtgacaatgaatacaagtacttctctaggagtgct
aacgagtacacagccacatttgggtccaacagctttgacgggaatttcacgcagtacatt
cacgacttgttcaagcctggaatcaagtcttgtatattagatggagaaatgctgggatac
catgctgaaactaagacttatgctaccaaggccatgaacacagacatcaaacgacaacaa
caggaagggtatcagccatgctataacatatttgatatcgtggtactcaatgacaaagtg
ctcaccaacaagcccctgagggagcgacttcagctgctggagacggtgatcgaccccgag
gaggggcgcattcagatcagcaagcacactgaggccaacacaaatcaggagtgtgctgac
gccttgaacaaagctatagacggcagagaggaggggataatggtaaagaaccctgactca
gtctacagacccaacaccaggaagggtgggtggatcaagattaaaccggagtacgtgggg
ggtctgatggacgagcttgatgttgtagtggtgggtgggtacctgggtgtcggccaccgt
ggcgggatgatgtcacacttcctctgtgctgtggcagtccctgtggatgacggagaaaaa
cctgaagtgttccattccttctgtaaggttggatctggatattctaaaaaagagctaggg
gaagttaatgagaagttgaaggatcattggaaggcgtttgacaagaggaaccctccgacc
tccatcattctggcctctggcttcaaggagaagccagacgcttggatagagcctagtaac
tcggttattgtccagataaaagcagcagagatcattgacagtgaccggtttaaaacaaat
tgtaccctgaggtttcctcgggtcgagtgtttccgtgacgacaaggcctggcatgattgt
atgactgtcacagacattttggaactgaaggagaagtctggaggtaaattagcgggtggt
aaggtggagcttgcggaaggagaggaaccagtaaagaagaaaagaaagattgttagtcga
gtggttcgcccgacccttggagctcagtttatgggagccgacctcacgtctgtcacacag
gtatcaaagatgttggagggaaaagagttttgtgtgattaatggcccatcgtcatttcca
aagcatgccatagaaacaaaaattgtagaatttggtggcaaaatagttcaaaatccaggt
ccgtccacgttctgtgtcctggcagacaaggtggctgtccgcgtcacaaacctcatcaaa
cgggacatgtacgatgttgttaaggtgtcgtggttccagcgttgtgtggatgccagccga
tggttaccatggtccccagctgatatgattcacacgtcacccaagacccagctggatttc
cagaagcaatatgatgagtttggggacagctatgtagatccgaccagtcctgaacaactg
aagactgtgtttagtagaatatctaaggttgaaaatgggatgacagatgccctggacata
gctgagatagagcaggcgtacttccccgatgattctccgtatggaatgttccgtacctgc
aggttttacatggatgacagtctagtcattgatgacaaatccacgaaatcaaaaaattcc
ttcctggacttcctggccctggagttacggttctttggtggtgccattgctgaagagatc
gaccctgctgtttctcatgttatgatggacaacagtgaccttagtcggctggaggaaata
aaggaaatgaggagacagaggaggaagaagtttcacattgtcactagattctgggtcaga
gaatgtatgcaggagggaaccctagtgtcagaacgcagatttgaaccatcctaa

DBGET integrated database retrieval system